Home » BPNT1 » BPNT1 Proteins » BPNT1 Recombinant Protein Antigen

BPNT1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for BPNT1 Protein (NBP2-14359PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

BPNT1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BPNT1.

Source: E. coli

Amino Acid Sequence: SEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BPNT1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14359.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BPNT1 Recombinant Protein Antigen

  • 3'(2'), 5'-bisphosphate nucleotidase 1,3'(2')5'-bisphosphate nucleotidase 1
  • Bisphosphate 3'-nucleotidase 1
  • BPntase
  • EC 3.1.3
  • EC 3.1.3.7
  • PAP-inositol-1,4-phosphatase
  • PIP

Background

BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Apolipoprotein D
Antibody
NBP2-42526
Immunohistochemistry-Paraffin Apolipoprotein D Antibody
Immunocytochemistry/ Immunofluorescence Apolipoprotein D Antibody
Immunocytochemistry/ Immunofluorescence Apolipoprotein D Antibody
(3 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MUC1 Antibody
(SM3) - BSA Free
NB120-22711
Immunocytochemistry/ Immunofluorescence MUC1 Antibody (SM3) - BSA Free
Flow Cytometry MUC1 Antibody (SM3) - BSA Free
Immunocytochemistry/ Immunofluorescence MUC1 Antibody (SM3) - BSA Free
(14 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Progesterone
R/NR3C3 Antibody [Unc ...
AF5415
Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]
Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Cytokeratin 7
Antibody (OV-TL12/30) ...
NBP2-47940
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Flow Cytometry Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
Simple Western Cytokeratin 7 Antibody (OV-TL12/30) - Azide and BSA Free
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, Simple Western, WB
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry Cytokeratin 20 Antibody (SA35-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 20 Antibody (SA35-03)
Immunohistochemistry-Paraffin Cytokeratin 20 Antibody (SA35-03)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(11 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
ABR Antibody
NBP1-30981
Immunocytochemistry/ Immunofluorescence ABR Antibody
Western Blot ABR Antibody
Western Blot ABR Antibody
Species: Hu, Mu
Applications: ICC/IF, WB
Mammaglobin A
Antibody (3C8) - BSA
NBP1-51671
Flow Cytometry Mammaglobin A Antibody (3C8) - BSA Free
Immunohistochemistry-Paraffin Mammaglobin A Antibody (3C8) - BSA Free
Western Blot Mammaglobin A Antibody (3C8) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
SGPL1 Antibody
[Unconjugated]
AF5535
Western Blot SGPL1 Antibody [Unconjugated]
Simple Western SGPL1 Antibody [Unconjugated]
(14 Publications)
Species: Hu
Applications: Simple Western, WB
ErbB2/Her2
[Unconjugated]
1129-ER
SDS-PAGE ErbB2/Her2 [Unconjugated]
Bioactivity ErbB2/Her2 [Unconjugated]
(58 Publications)
Species: Hu
Applications: BA
CEACAM5/CD66e
Antibody (CEA31) - Az ...
NBP2-34594
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
Immunohistochemistry-Paraffin CEACAM5/CD66e Antibody (CEA31) - Azide and BSA Free
(2 Reviews)
Species: Hu, Pm
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P
CEACAM7 Antibody
[Unconjugated]
AF4478
Immunohistochemistry CEACAM7 Antibody [Unconjugated]
Western Blot CEACAM7 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC, WB
PSG2 Antibody
NBP3-41306
Western Blot PSG2 Antibody
Western Blot PSG2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
PU.1/Spi-1 Antibody
NBP2-27163
Western Blot PU.1/Spi-1 Antibody
Western Blot PU.1/Spi-1 Antibody
Flow Cytometry PU.1/Spi-1 Antibody
(1 Review)
(1 Publication)
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
Substance P
Antibody (266815)
MAB4375
Immunohistochemistry Substance P Antibody (266815)
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC
IRF8 Antibody
NBP1-81614
Immunohistochemistry-Paraffin IRF8 Antibody
Immunohistochemistry-Paraffin IRF8 Antibody
Western Blot IRF8 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
BPNT1 Recombinant
Protein Antigen
NBP2-14359PEP
BPNT1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for BPNT1 Protein (NBP2-14359PEP) (0)

There are no publications for BPNT1 Protein (NBP2-14359PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPNT1 Protein (NBP2-14359PEP) (0)

There are no reviews for BPNT1 Protein (NBP2-14359PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BPNT1 Protein (NBP2-14359PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BPNT1 Products

Research Areas for BPNT1 Protein (NBP2-14359PEP)

Find related products by research area.

Blogs on BPNT1

There are no specific blogs for BPNT1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BPNT1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BPNT1