Novus Biologicals products are now on bio-techne.com

Bcl rambo Recombinant Protein Antigen

Images

 
There are currently no images for Bcl rambo Recombinant Protein Antigen (NBP2-58417PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Bcl rambo Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Bcl rambo.

Source: E. coli

Amino Acid Sequence: MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVKTEIEEELKSLDKEISEAFTSTGFDRHTS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BCL2L13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58417.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Bcl rambo Recombinant Protein Antigen

  • Bcl2-L-13
  • BCL2-like 13 (apoptosis facilitator)
  • bcl-2-like protein 13
  • Bcl-rambo
  • MIL1BCL-RAMBO
  • Protein Mil1

Background

Apoptosis plays a major role in normal organism development, tissue homeostasis, and removal of damaged cells. Disruption of this process has been implicated in a variety of diseases such as cancer. Members of the Bcl-2 family are known to be critical regulators of this process. These proteins are characterized by the presence of several conserved motifs termed Bcl-2 homology (BH) domains. A novel, widely expressed member termed Bcl-rambo was recently identified. This protein is localized to mitochondria in mammalian cells and its overexpression induces apoptosis which could be blocked by co-expression of inhibitor of apoptosis proteins (IAPs) such as XIAP, cIAP1, and cIAP2. Bcl-rambo shows overall homology to the anti-apoptotic members containing BH motifs, but unlike Bcl-2, the C-terminal membrane anchor of Bcl-rambo is preceded by a unique 250 amino acid insertion. This region by itself can induce apoptosis more efficiently than the Bcl-2 homology regions, suggesting that Bcl-rambo may be important other pro-apoptotic pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-56146
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NB100-56150
Species: Ch, Hu, Mu(-), Po, Rt, Xp
Applications: IHC, IHC-P, WB
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NBP2-61706
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP1-76963
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
M5000
Species: Mu
Applications: ELISA
NBP1-89929
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88640
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-92642
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KO, WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-04913
Species: Hu, Mu, Rt
Applications: WB
NB100-56311
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56548
Species: Hu
Applications: ICC/IF, WB
NB100-56109
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for Bcl rambo Recombinant Protein Antigen (NBP2-58417PEP) (0)

There are no publications for Bcl rambo Recombinant Protein Antigen (NBP2-58417PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bcl rambo Recombinant Protein Antigen (NBP2-58417PEP) (0)

There are no reviews for Bcl rambo Recombinant Protein Antigen (NBP2-58417PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Bcl rambo Recombinant Protein Antigen (NBP2-58417PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Bcl rambo Products

Research Areas for Bcl rambo Recombinant Protein Antigen (NBP2-58417PEP)

Find related products by research area.

Blogs on Bcl rambo

There are no specific blogs for Bcl rambo, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Bcl rambo Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BCL2L13