| Reactivity | HuSpecies Glossary |
| Applications | AC |
| Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Atrial Natriuretic Peptide/ANP Source: E. coli Amino Acid Sequence: QRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source | E. coli |
| Protein/Peptide Type | Recombinant Protein Antigen |
| Gene | NPPA |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
| Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17073. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW | 24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS and 1M Urea, pH 7.4. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NPPA |
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
![Western Blot IFN-alpha/beta R1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af245_mouse-tsp50-affinity-purified-polyclonal-ab-western-blot-672022104711.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/Endothelin-1_QET00_ELISA_432.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/DATA_Endothelin1_QET00_ELISA_1074.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/Angiogenin_DAN00_ELISA_28.jpg)
![N/A Angiogenin [HRP]](https://images.novusbio.com/images2/DATA_Angiogenin_DAN00_ELISA_571.jpg)
