![Sandwich ELISA: ATP6V0D2 Antibody (7A4) [H00245972-M01] - Detection limit for recombinant GST tagged ATP6V0D2 is 0.03 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ATP6V0D2-Antibody-7A4-Sandwich-ELISA-H00245972-M01-img0001.jpg "Sandwich ELISA: ATP6V0D2 Antibody (7A4) [H00245972-M01] - Detection limit for recombinant GST tagged ATP6V0D2 is 0.03 ng/ml as a capture antibody.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 7A4 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ATP6V0D2 (NP_689778, 238 a.a. ~ 306 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFN |
| Specificity | ATP6V0D2 - ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2 |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ATP6V0D2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
