![Western Blot: Annexin A1 Antibody (CL0199) [NBP2-52875] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-ANXA1 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/Annexin-A1-Antibody-CL0199-Western-Blot-NBP2-52875-img0007.jpg "Western Blot: Annexin A1 Antibody (CL0199) [NBP2-52875] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-ANXA1 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clone | CL0199 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FRNALLSLAKGDRSEDFGVNEDLADSDARALYEAGERRKGTDVNVFNTILTTRSYPQLRRVFQKYTKYSKHDMNKVLDLELKGDIEKCLTAIVKCATSKPAFFAEKLHQAMKGVGTRHKALIRIMV |
| Epitope | PQLRRVFQKY |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ANXA1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Annexin A1 Antibody (NBP2-52875)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ANXA1 |
![Immunocytochemistry/Immunofluorescence: Annexin A1 Antibody (CL0199) [NBP2-52875] - Staining of A549 cells using the Anti-ANXA1 monoclonal antibody, showing specific staining in the nucleus, cytosol and the plasma membrane in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).](http://images.novusbio.com/fullsize/Annexin-A1-Antibody-CL0199-Immunocytochemistry-Immunofluorescence-NBP2-52875-img0008.jpg "Immunocytochemistry/Immunofluorescence: Annexin A1 Antibody (CL0199) [NBP2-52875] - Staining of A549 cells using the Anti-ANXA1 monoclonal antibody, showing specific staining in the nucleus, cytosol and the plasma membrane in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).")
![Immunohistochemistry-Paraffin: Annexin A1 Antibody (CL0199) [NBP2-52875] - Staining of human placenta shows strong immunoreactivity in the trophoblast cells.](http://images.novusbio.com/fullsize/Annexin-A1-Antibody-CL0199-Immunohistochemistry-Paraffin-NBP2-52875-img0005.jpg "Immunohistochemistry-Paraffin: Annexin A1 Antibody (CL0199) [NBP2-52875] - Staining of human placenta shows strong immunoreactivity in the trophoblast cells.")
![Western Blot: Annexin A1 Antibody (CL0199) [NBP2-52875] - Lane 1: Marker [kDa] Lane 2: Human cell line U-251 MG](http://images.novusbio.com/fullsize/Annexin-A1-Antibody-CL0199-Western-Blot-NBP2-52875-img0006.jpg "Western Blot: Annexin A1 Antibody (CL0199) [NBP2-52875] - Lane 1: Marker [kDa] Lane 2: Human cell line U-251 MG")
![Immunohistochemistry-Paraffin: Annexin A1 Antibody (CL0199) [NBP2-52875] - Staining of human bone marrow shows strong nuclear immunoreactivity in a subset of lymphoid cells.](http://images.novusbio.com/fullsize/Annexin-A1-Antibody-CL0199-Immunohistochemistry-Paraffin-NBP2-52875-img0001.jpg "Immunohistochemistry-Paraffin: Annexin A1 Antibody (CL0199) [NBP2-52875] - Staining of human bone marrow shows strong nuclear immunoreactivity in a subset of lymphoid cells.")
![Immunohistochemistry-Paraffin: Annexin A1 Antibody (CL0199) [NBP2-52875] - Staining of human bronchus shows distinct positivity in ciliated epithelial cells.](http://images.novusbio.com/fullsize/Annexin-A1-Antibody-CL0199-Immunohistochemistry-Paraffin-NBP2-52875-img0002.jpg "Immunohistochemistry-Paraffin: Annexin A1 Antibody (CL0199) [NBP2-52875] - Staining of human bronchus shows distinct positivity in ciliated epithelial cells.")
![Immunohistochemistry-Paraffin: Annexin A1 Antibody (CL0199) [NBP2-52875] - Staining of human fallopian tube shows strong positivity in the glandular cells.](http://images.novusbio.com/fullsize/Annexin-A1-Antibody-CL0199-Immunohistochemistry-Paraffin-NBP2-52875-img0003.jpg "Immunohistochemistry-Paraffin: Annexin A1 Antibody (CL0199) [NBP2-52875] - Staining of human fallopian tube shows strong positivity in the glandular cells.")
![Immunohistochemistry-Paraffin: Annexin A1 Antibody (CL0199) [NBP2-52875] - Staining of human lung shows nuclear positivity in a subset of pneumocytes and lymphoid cells.](http://images.novusbio.com/fullsize/Annexin-A1-Antibody-CL0199-Immunohistochemistry-Paraffin-NBP2-52875-img0004.jpg "Immunohistochemistry-Paraffin: Annexin A1 Antibody (CL0199) [NBP2-52875] - Staining of human lung shows nuclear positivity in a subset of pneumocytes and lymphoid cells.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SEC-MALS IL-23A/IL-23 P19 [Unconjugated]](https://images.novusbio.com/images/1290-il_recombinant-human-il-23-protein-sec-mals-1012202411154..jpg)
![N/A Lipocalin-2/NGAL [Biotin]](https://images.novusbio.com/images2/DATA_Lipocalin2_DY1857_ELISA_2306.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")