![Immunocytochemistry/Immunofluorescence: ALOX12B Antibody [NBP1-89409] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ALOX12B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89409-img0004.jpg "Immunocytochemistry/Immunofluorescence: ALOX12B Antibody [NBP1-89409] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ALOX12B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ALOX12B Antibody (NBP1-89409)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ALOX12B |
![Immunohistochemistry-Paraffin: ALOX12B Antibody [NBP1-89409] - Staining of human skin shows strong cytoplasmic positivity in keratinocytes.](http://images.novusbio.com/fullsize/ALOX12B-Antibody-Immunohistochemistry-Paraffin-NBP1-89409-img0007.jpg "Immunohistochemistry-Paraffin: ALOX12B Antibody [NBP1-89409] - Staining of human skin shows strong cytoplasmic positivity in keratinocytes.")
![Immunohistochemistry-Paraffin: ALOX12B Antibody [NBP1-89409] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/ALOX12B-Antibody-Immunohistochemistry-Paraffin-NBP1-89409-img0005.jpg "Immunohistochemistry-Paraffin: ALOX12B Antibody [NBP1-89409] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry: ALOX12B Antibody [NBP1-89409] - Analysis of ALOX12B and PTGIS proteins expression in tumor and non-tumor tissue by Immunohistochemistry. Expression of ALOX12B protein; the arrows show weak labeling (brown staining) of non-tumor squamous cells in (a) and OSCC cells in (b). Image collected and cropped by CiteAb from the following publication (//www.hindawi.com/journals/jo/2018/6301980/), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/ALOX12B-Antibody-Immunohistochemistry-NBP1-89409-img0008.jpg "Immunohistochemistry: ALOX12B Antibody [NBP1-89409] - Analysis of ALOX12B and PTGIS proteins expression in tumor and non-tumor tissue by Immunohistochemistry. Expression of ALOX12B protein; the arrows show weak labeling (brown staining) of non-tumor squamous cells in (a) and OSCC cells in (b). Image collected and cropped by CiteAb from the following publication (//www.hindawi.com/journals/jo/2018/6301980/), licensed under a CC-BY license.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")