Home » Gelsolin/GSN » Gelsolin/GSN Proteins » Gelsolin/GSN Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Gelsolin/GSN Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Gelsolin/GSN Recombinant Protein Antigen (NBP2-55565PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Gelsolin/GSN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Gelsolin/GSN.

Source: E. coli

Amino Acid Sequence: AFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQPVQVAEGSEPDGFWEALGGKAAYRTSPRLKDKKMDAHPPR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GSN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55565.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Gelsolin/GSN Recombinant Protein Antigen

  • Actin-depolymerizing factor
  • ADF
  • AGEL
  • Brevin
  • DKFZp313L0718
  • gelsolin (amyloidosis, Finnish type)
  • Gelsolin
  • GSN

Background

Gelsolin is a calcium regulated actin binding protein. Gelsolin is a regulator of actin filament assembly and disassembly and consists of six homologous subdomains (S1-S6). When C-terminal tail (S6) is bound to calcium ion, it straightens and exposes actin binding sites located on S2s helices, leading to Gelsolin actin-serving activity (1). Gelsolin is inhibited by phosphatidylinositol (4,5)-bisphosphate (PIP2), where PIP2 will bind to S1, S2, and S3 sites. Gelsolin is involved in podosome formation and has been linked to inhibition of apoptosis by preventing release of cytochrome C (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DMPK Antibody
(713931)
MAB6967
Western Blot DMPK Antibody (713931)
Species: Hu
Applications: WB
Destrin Antibody
(OTI2F7)
NBP2-00527
Flow Cytometry Destrin Antibody (OTI2F7)
Flow Cytometry Destrin Antibody (OTI2F7)
Flow Cytometry Destrin Antibody (OTI2F7)
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Neuregulin-1/NRG1
Antibody (147724) [Un ...
MAB377
Neuregulin-1/NRG1 Antibody (147724) [Unconjugated]
(85 Publications)
Species: Hu
Applications: WB
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry Ceruloplasmin Antibody (6C3K9)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(388 Publications)
Species: Hu, Mu
Applications: ICC, IHC
Thioredoxin-1
Antibody - BSA Free
NBP2-52983
Flow Cytometry Thioredoxin-1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Thioredoxin-1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Thioredoxin-1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
ACTR2 Antibody
(1B10-C4)
H00010097-M01
Western Blot ACTR2 Antibody (1B10-C4)
Immunohistochemistry-Paraffin ACTR2 Antibody (1B10-C4)
Sandwich ELISA ACTR2 Antibody (1B10-C4)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Myosin Heavy Chain
Antibody (MF20) [Unco ...
MAB4470
Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
(1 Review)
(165 Publications)
Species: All-Multi
Applications: ICC, IHC, WB
SCIN Antibody
NBP1-89230
Western Blot SCIN Antibody
Immunohistochemistry-Paraffin SCIN Antibody
Immunohistochemistry-Paraffin SCIN Antibody
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
LIM Kinase 1
Antibody (OTI3H6)
NBP2-00748
Flow Cytometry LIM Kinase 1 Antibody (OTI3H6)
Western Blot LIM Kinase 1 Antibody (OTI3H6)
Immunohistochemistry-Paraffin LIM Kinase 1 Antibody (OTI3H6)
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AICDA Antibody
NBP1-30955
Immunocytochemistry/ Immunofluorescence AICDA Antibody
Immunohistochemistry-Paraffin AICDA Antibody
Western Blot AICDA Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Angiopoietin-like
Protein 2/ANGPTL2 Ant ...
AF1444
Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: IHC, WB
GRB2 Antibody
[Unconjugated]
AF3846
Western Blot GRB2 Antibody [Unconjugated]
Immunohistochemistry GRB2 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
DNASE1 Antibody
NBP1-84999
Immunohistochemistry-Paraffin DNASE1 Antibody
Western Blot DNASE1 Antibody
Immunohistochemistry-Paraffin DNASE1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Vinculin Antibody
(728526) [Unconjugate ...
MAB6896
Simple Western Vinculin Antibody (728526) [Unconjugated]
Western Blot Vinculin Antibody (728526) [Unconjugated]
Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]
(3 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB

Transthyretin/Prealbum ...
NBP2-52575
Flow Cytometry Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
Immunocytochemistry/ Immunofluorescence Transthyretin/Prealbumin Antibody (2E10C5) - BSA Free
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Recombinant Human
ARSH GST (N-Term) Pro ...
H00347527-P01
Other Recombinant Human ARSH GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
Vitamin D BP
Antibody
NBP1-88027
Western Blot Vitamin D BP Antibody
Western Blot Vitamin D BP Antibody
Western Blot Vitamin D BP Antibody
(2 Reviews)
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Gelsolin/GSN
Recombinant Protein A ...
NBP2-55565PEP
Gelsolin/GSN Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Gelsolin/GSN Recombinant Protein Antigen (NBP2-55565PEP) (0)

There are no publications for Gelsolin/GSN Recombinant Protein Antigen (NBP2-55565PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gelsolin/GSN Recombinant Protein Antigen (NBP2-55565PEP) (0)

There are no reviews for Gelsolin/GSN Recombinant Protein Antigen (NBP2-55565PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Gelsolin/GSN Recombinant Protein Antigen (NBP2-55565PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gelsolin/GSN Products

Research Areas for Gelsolin/GSN Recombinant Protein Antigen (NBP2-55565PEP)

Find related products by research area.

Blogs on Gelsolin/GSN

There are no specific blogs for Gelsolin/GSN, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Gelsolin/GSN Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GSN