Novus Biologicals products are now on bio-techne.com

TR alpha/NR1A1/Thyroid Hormone Receptor alpha Recombinant Protein Antigen

Images

 
There are currently no images for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Protein (NBP1-90118PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

TR alpha/NR1A1/Thyroid Hormone Receptor alpha Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human THRA.

Source: E. coli

Amino Acid Sequence: AFEHYVNHRKHNIPHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQLGEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
THRA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90118.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Recombinant Protein Antigen

  • AR7
  • c-ERBA-1
  • c-erbA-alpha
  • EAR7
  • EAR-7
  • EAR-7.1/EAR-7.2
  • ERBA
  • ERBA1thyroid hormone receptor, alpha (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog)
  • ERBA-related 7
  • MGC000261
  • MGC43240
  • NR1A 1
  • NR1A1
  • NR1A1THRA3
  • Nuclear receptor subfamily 1 group A member 1
  • THRA
  • THRA1ERB-T-1
  • THRA2
  • thyroid hormone receptor alpha
  • thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a)oncogene homolog, avian)
  • TR alpha
  • triiodothyronine receptor
  • v-ErbA1
  • V-erbA-related protein 7

Background

Thyroid Hormone Receptor alpha is encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

1670-SE
Species: Ec
Applications: EnzAct
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr, IHC-P, WB
NBP2-94256
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-92243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PLA, WB
MAB7428
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
NB200-322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
1129-ER
Species: Hu
Applications: BA
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
H00009572-M02
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, KD, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB

Publications for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Protein (NBP1-90118PEP) (0)

There are no publications for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Protein (NBP1-90118PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Protein (NBP1-90118PEP) (0)

There are no reviews for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Protein (NBP1-90118PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Protein (NBP1-90118PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TR alpha/NR1A1/Thyroid Hormone Receptor alpha Products

Research Areas for TR alpha/NR1A1/Thyroid Hormone Receptor alpha Protein (NBP1-90118PEP)

Find related products by research area.

Blogs on TR alpha/NR1A1/Thyroid Hormone Receptor alpha

There are no specific blogs for TR alpha/NR1A1/Thyroid Hormone Receptor alpha, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TR alpha/NR1A1/Thyroid Hormone Receptor alpha Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol THRA