![Immunohistochemistry-Paraffin: TNP1 Antibody (1B5) [H00007141-M01] - Analysis of monoclonal antibody to TNP1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/TNP1-Antibody-1B5-Immunohistochemistry-Paraffin-H00007141-M01-img0004.jpg "Immunohistochemistry-Paraffin: TNP1 Antibody (1B5) [H00007141-M01] - Analysis of monoclonal antibody to TNP1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 1B5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | TNP1 (AAH29516.1, 1 a.a. ~ 55 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL |
| Specificity | TNP1 - transition protein 1 (during histone to protamine replacement) |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TNP1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Western_Blot_5922.jpg)
![Simple Western PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/16342.jpg)
![Knockout Validated PTEN Antibody [Unconjugated]](https://images.novusbio.com/images2/PTEN_AF847_Knockout_Validated_22996.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Sandwich ELISA: TNP1 Antibody (1B5) [H00007141-M01] - Detection limit for recombinant GST tagged TNP1 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/TNP1-Antibody-1B5-Sandwich-ELISA-H00007141-M01-img0005.jpg "Sandwich ELISA: TNP1 Antibody (1B5) [H00007141-M01] - Detection limit for recombinant GST tagged TNP1 is approximately 0.03ng/ml as a capture antibody.")
