![Western Blot: Syntaxin 4 Antibody (6D1) [H00006810-M04] - Analysis of STX4A expression in NIH/3T3 (Cat # L018V1).](http://images.novusbio.com/fullsize/Syntaxin-4-Antibody-6D1-Western-Blot-H00006810-M04-img0011.jpg "Western Blot: Syntaxin 4 Antibody (6D1) [H00006810-M04] - Analysis of STX4A expression in NIH/3T3 (Cat # L018V1).")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 6D1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | STX4A (NP_004595, 19 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVN |
| Specificity | STX4A (6D1) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | STX4 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot Syntaxin-BP3/Munc18c Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin-BP3_AF5659_Western_Blot_12110.jpg)
![Immunohistochemistry Epimorphin/Syntaxin 2 Antibody (338930) [Unconjugated]](https://images.novusbio.com/images2/Epimorphin_MAB2568_Immunohistochemistry_6977.jpg)
| Publication using H00006810-M04 | Applications | Species |
|---|---|---|
| Larkin C Examining the TRPV3 cation channel in a culture model of human epidermis Thesis 2023-01-01 (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Syntaxin 4 Antibody (H00006810-M04)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Syntaxin 4 Antibody (6D1) [H00006810-M04] - Analysis of monoclonal antibody to STX4A on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/Syntaxin-4-Antibody-6D1-Immunocytochemistry-Immunofluorescence-H00006810-M04-img0007.jpg "Immunocytochemistry/Immunofluorescence: Syntaxin 4 Antibody (6D1) [H00006810-M04] - Analysis of monoclonal antibody to STX4A on HeLa cell. Antibody concentration 10 ug/ml")
![Western Blot: Syntaxin 4 Antibody (6D1) [H00006810-M04] - Analysis of STX4A expression in HeLa (Cat # L013V1).](http://images.novusbio.com/fullsize/Syntaxin-4-Antibody-6D1-Western-Blot-H00006810-M04-img0009.jpg "Western Blot: Syntaxin 4 Antibody (6D1) [H00006810-M04] - Analysis of STX4A expression in HeLa (Cat # L013V1).")
![Western Blot: Syntaxin 4 Antibody (6D1) [H00006810-M04] - Analysis of STX4A expression in Raw 264.7 (Cat # L024V1).](http://images.novusbio.com/fullsize/Syntaxin-4-Antibody-6D1-Western-Blot-H00006810-M04-img0010.jpg "Western Blot: Syntaxin 4 Antibody (6D1) [H00006810-M04] - Analysis of STX4A expression in Raw 264.7 (Cat # L024V1).")
![Western Blot: Syntaxin 4 Antibody (6D1) [H00006810-M04] - Analysis of STX4 expression in transfected 293T cell line by STX4A monoclonal antibody (M04), clone 6D1. Lane 1: STX4 transfected lysate (Predicted MW: 34.2 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Syntaxin-4-Antibody-6D1-Western-Blot-H00006810-M04-img0012.jpg "Western Blot: Syntaxin 4 Antibody (6D1) [H00006810-M04] - Analysis of STX4 expression in transfected 293T cell line by STX4A monoclonal antibody (M04), clone 6D1. Lane 1: STX4 transfected lysate (Predicted MW: 34.2 KDa). Lane 2: Non-transfected lysate.")
![Sandwich ELISA: Syntaxin 4 Antibody (6D1) [H00006810-M04] - Detection limit for recombinant GST tagged STX4A is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Syntaxin-4-Antibody-6D1-Sandwich-ELISA-H00006810-M04-img0008.jpg "Sandwich ELISA: Syntaxin 4 Antibody (6D1) [H00006810-M04] - Detection limit for recombinant GST tagged STX4A is approximately 0.1ng/ml as a capture antibody.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot VAMP-8 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP-8_AF5354_Western_Blot_5695.jpg)
![Immunohistochemistry VAMP-8 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP8_AF5354_Immunohistochemistry_19693.jpg)
![Western Blot VAMP-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP-1_AF4828_Western_Blot_5561.jpg)
![Immunohistochemistry VAMP-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VAMP-1_AF4828_Immunohistochemistry_6847.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")