![Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining in human testis and prostate tissues using anti-SPESP1 antibody. Corresponding SPESP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SPESP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13370-img0006.jpg "Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining in human testis and prostate tissues using anti-SPESP1 antibody. Corresponding SPESP1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: YPSITVTPDEEQNLNHYIQVLENLVRSVPSGEPGREKKSNSPKHVYSIASKGSKFKELVTHGDASTENDVLTNPISEETTTFPTG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SPESP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SPESP1 |
![Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining of human cerebral cortex, endometrium, lymph node and testis using Anti-SPESP1 antibody NBP2-13370 (A) shows similar protein distribution across tissues to independent antibody NBP2-48994 (B).](http://images.novusbio.com/fullsize/SPESP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13370-img0007.jpg "Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining of human cerebral cortex, endometrium, lymph node and testis using Anti-SPESP1 antibody NBP2-13370 (A) shows similar protein distribution across tissues to independent antibody NBP2-48994 (B).")
![Western Blot: SPESP1 Antibody [NBP2-13370] - Analysis using Anti-SPESP1 antibody NBP2-13370 (A) shows similar pattern to independent antibody NBP2-48994 (B).](http://images.novusbio.com/fullsize/SPESP1-Antibody-Western-Blot-NBP2-13370-img0008.jpg "Western Blot: SPESP1 Antibody [NBP2-13370] - Analysis using Anti-SPESP1 antibody NBP2-13370 (A) shows similar pattern to independent antibody NBP2-48994 (B).")
![Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining of human lymph node.](http://images.novusbio.com/fullsize/SPESP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13370-img0011.jpg "Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining of human testis shows strong cytoplasmic positivity in spermatids/ acrosomal cap.](http://images.novusbio.com/fullsize/SPESP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13370-img0001.jpg "Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining of human testis shows strong cytoplasmic positivity in spermatids/ acrosomal cap.")
![Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining of human prostate shows low expression as expected.](http://images.novusbio.com/fullsize/SPESP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13370-img0005.jpg "Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining of human prostate shows low expression as expected.")
![Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining of human endometrium.](http://images.novusbio.com/fullsize/SPESP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13370-img0009.jpg "Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining of human endometrium.")
![Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/SPESP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13370-img0010.jpg "Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining of human cerebral cortex.")
![Western Blot GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Western_Blot_5355.jpg)
![Immunohistochemistry GRB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/GRB2_AF3846_Immunohistochemistry_6809.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry CRIPTO Antibody [Unconjugated]](https://images.novusbio.com/images2/Cripto_AF1538_Immunocytochemistry__Immunofluorescence_20121.jpg)
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")