Home » SLC15A4 » SLC15A4 Proteins » SLC15A4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SLC15A4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SLC15A4 Protein (NBP1-87279PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SLC15A4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC15A4.

Source: E. coli

Amino Acid Sequence: TKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC15A4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87279.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SLC15A4 Recombinant Protein Antigen

  • Peptide transporter 4
  • Peptide/histidine transporter 1
  • PHT1hPHT1
  • PTR4peptide-histidine transporter 4
  • solute carrier family 15 member 4
  • solute carrier family 15, member 4

Background

Proton oligopeptide cotransporter. Transports free histidine and certain di- and tripeptides

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PEPT1/SLC15A1
Antibody
NBP1-92005
Immunohistochemistry-Paraffin PEPT1/SLC15A1 Antibody
Immunocytochemistry/ Immunofluorescence PEPT1/SLC15A1 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Glutathione
S-Transferase pi 1/GS ...
NBP2-16756
Western Blot Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunocytochemistry/ Immunofluorescence Glutathione S-Transferase pi 1/GSTP1 Antibody
Immunohistochemistry-Paraffin Glutathione S-Transferase pi 1/GSTP1 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Serpin A1/alpha
1-Antitrypsin Antibod ...
MAB1268
Western Blot Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Simple Western Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
Immunocytochemistry Serpin A1/alpha 1-Antitrypsin Antibody (202808) [Unconjugated]
(1 Review)
(13 Publications)
Species: Hu
Applications: ICC, IHC, IP, Simple Western, WB
Cadherin-17
Antibody (141713) [Un ...
MAB1032
Western Blot Cadherin-17 Antibody (141713) [Unconjugated]
Immunohistochemistry Cadherin-17 Antibody (141713) [Unconjugated]
Immunohistochemistry Cadherin-17 Antibody (141713) [Unconjugated]
(5 Publications)
Species: Hu
Applications: IHC, WB
G protein alpha
inhibitor 1 Antibody ...
H00002770-M01
Western Blot G protein alpha inhibitor 1 Antibody (2B8-2A5)
Immunohistochemistry-Paraffin G protein alpha inhibitor 1 Antibody (2B8-2A5)
Sandwich ELISA G protein alpha inhibitor 1 Antibody (2B8-2A5)
(1 Publication)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB

beta-Glucuronidase/GUS
NBP1-87511
Immunocytochemistry/ Immunofluorescence beta-Glucuronidase/GUSB Antibody
Immunohistochemistry-Paraffin beta-Glucuronidase/GUSB Antibody
Immunohistochemistry-Paraffin beta-Glucuronidase/GUSB Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TLR9 Antibody
(26C593.2) - BSA Free
NBP2-24729
Immunohistochemistry-Paraffin TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
(4 Reviews)
(155 Publications)
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
Choline
Acetyltransferase/ChA
NBP1-30052
Immunohistochemistry-Paraffin Choline Acetyltransferase/ChAT Antibody
Immunocytochemistry/ Immunofluorescence Choline Acetyltransferase/ChAT Antibody
Immunocytochemistry/ Immunofluorescence Choline Acetyltransferase/ChAT Antibody
(24 Publications)
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
Pallidin Antibody
(OTI1H9)
NBP2-01763
Western Blot Pallidin Antibody (OTI1H9)
Flow Cytometry Pallidin Antibody (OTI1H9)
Immunohistochemistry-Paraffin Pallidin Antibody (OTI1H9)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NOD1 Antibody
NB100-56152
Western Blot NOD1 Antibody
Immunohistochemistry-Paraffin NOD1 Antibody
Immunohistochemistry-Paraffin NOD1 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Ikaros/IKZF1
Antibody [Unconjugate
AF4984
Western Blot Ikaros/IKZF1 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) Ikaros/IKZF1 Antibody [Unconjugated]
Simple Western Ikaros/IKZF1 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: ChIP, CyTOF-ready, ICC, ICFlow, Simple Western, WB
TLR7 Antibody -
BSA Free
NBP2-24906
Immunocytochemistry/ Immunofluorescence TLR7 Antibody - BSA Free
Immunohistochemistry-Frozen TLR7 Antibody - BSA Free
Immunohistochemistry TLR7 Antibody - BSA Free
(4 Reviews)
(80 Publications)
Species: Hu, Mu, Rt
Applications: BA, DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, WB
PHF1 Antibody
NBP1-82613
Immunohistochemistry PHF1 Antibody
Western Blot PHF1 Antibody
Immunohistochemistry-Paraffin PHF1 Antibody
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CDC2L5 Antibody
(1B3-1B11)
H00008621-M01
Western Blot CDC2L5 Antibody (1B3-1B11)
Immunocytochemistry/ Immunofluorescence CDC2L5 Antibody (1B3-1B11)
Western Blot CDC2L5 Antibody (1B3-1B11)
Species: Hu
Applications: ELISA, ICC/IF, Simple Western, WB

Publications for SLC15A4 Protein (NBP1-87279PEP) (0)

There are no publications for SLC15A4 Protein (NBP1-87279PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC15A4 Protein (NBP1-87279PEP) (0)

There are no reviews for SLC15A4 Protein (NBP1-87279PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SLC15A4 Protein (NBP1-87279PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC15A4 Products

Array NBP1-87279PEP

Blogs on SLC15A4

There are no specific blogs for SLC15A4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Paraffin: TLR9 Antibody (26C593.2) [NBP2-24729] - Monkey retina tissue. Image from verified customer review.
TLR9 Antibody (26C593.2) - BSA Free
NBP2-24729
Immunocytochemistry/Immunofluorescence: TLR7 Antibody [NBP2-24906] - Analysis using the Azide Free version of NBP2-24906. Staining of Raw 246.7 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Image objective 40x. An antibody dilution of 1:10 was used.
TLR7 Antibody - BSA Free
NBP2-24906

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SLC15A4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SLC15A4