![Western Blot: SLC10A6 Antibody [H00345274-B01P] - Analysis of SLC10A6 expression in transfected 293T cell line by SLC10A6 polyclonal antibody. Lane 1: SLC10A6 transfected lysate(41.47 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/SLC10A6-Antibody-Western-Blot-H00345274-B01P-img0002.jpg "Western Blot: SLC10A6 Antibody [H00345274-B01P] - Analysis of SLC10A6 expression in transfected 293T cell line by SLC10A6 polyclonal antibody. Lane 1: SLC10A6 transfected lysate(41.47 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | SLC10A6 (NP_932069, 1 a.a. - 377 a.a.) full-length human protein. MRANCSSSSACPANSSEEELPVGLEVHGNLELVFTVVSTVMMGLLMFSLGCSVEIRKLWSHIRRPWGIAVGLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVDGDMDLSISMTTCSTVAALGMMPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGVYVNYRWPKQSKIILKIGAVVGGVLLLVVAVAGVVLAKGSWNSDITLLTISFIFPLIGHVTGFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLSFTAEHLVQMLSFPLAYGLFQLIDGFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGPMDCHRALEPVGHITSCE |
| Specificity | SLC10A6 - solute carrier family 10 (sodium/bile acid cotransporter family), member 6, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | SLC10A6 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")