Novus Biologicals products are now on bio-techne.com

Recombinant Human SI Sucrase-Isomaltase GST (N-Term) Protein

Name: Recombinant Human SI Sucrase-Isomaltase GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00006476-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human SI Sucrase-Isomaltase GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1728-1826 of Human SI Sucrase-Isomaltase Source: Wheat Germ (in vitro) Amino Acid Sequence: DGESIDTYERDLYLSVQFNLNQTTLTSTILKRGYINKSETRLGSLHVWGKGTTPVNAVTLTYNGNKNSLPFNEDTTNMILRIDLTTHNVTLEEPIEINW
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Partial Recombinant Protein
Gene	SI
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	36.63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SI Sucrase-Isomaltase GST (N-Term) Protein

EC 3.2.1.20
MGC131621
MGC131622
oligosaccharide alpha-1,6-glucosidase
sucrase-isomaltase (alpha-glucosidase)
sucrase-isomaltase
sucrase-isomaltase, intestinal

Background

SI - sucrase-isomaltase (alpha-glucosidase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

CD55/DAF Antibody
[Unconjugated]

AF2009

Immunocytochemistry CD55/DAF Antibody [Unconjugated]

(8 Publications)

Species: Hu

Applications: ICC, IHC

Calretinin Antibody

NBP1-88220

Immunohistochemistry-Paraffin Calretinin Antibody

(1 Review)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

CD21 Antibody
(SC0681)

NBP2-67605

Immunohistochemistry-Paraffin CD21 Antibody (SC0681)

(1 Publication)

Species: Hu, Pm, Mu

Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB

DHRS4 Antibody

NBP2-98675

Species: Hu

Applications: IHC-P, IP, WB

CRIPTO Antibody -
BSA Free

NB100-1598

(3 Publications)

Species: Hu, Mu

Applications: Flow, ICC/IF, WB

HAI-2/SPINT2
Antibody [Unconjugate

AF1107

(3 Publications)

Species: Mu

Applications: IHC, WB

Histatin 3
Antibody (4G9)

H00003347-M01

Immunocytochemistry/ Immunofluorescence Histatin 3 Antibody (4G9)

(1 Publication)

Species: Hu

Applications: ELISA, ICC/IF, S-ELISA, WB

NDUFB6 Antibody

NBP1-92172

Immunocytochemistry/ Immunofluorescence NDUFB6 Antibody

(2 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Chromogranin C
Antibody

NBP2-15895

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Siglec-1/CD169
Antibody (HSn 7D2) - ...

NB600-534

Immunohistochemistry-Paraffin Siglec-1/CD169 Antibody (HSn 7D2) - BSA Free

Flow Cytometry Siglec-1/CD169 Antibody (HSn 7D2) - BSA Free

(1 Review)

(23 Publications)

Species: Hu, Mu, Po, V-Vi

Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, In vivo, RIA, WB

Afamin Antibody

NBP1-89156

Species: Hu

Applications: IHC, IHC-P

PMEL17/SILV
Antibody (HMB45)

NBP2-44520

Immunohistochemistry PMEL17/SILV Antibody (HMB45)

(8 Publications)

Species: Ca(-), Hu, Rt(-)

Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB

CTLA-4
[Unconjugated]

7268-CT

(3 Publications)

Species: Hu

Applications: BA

Complement C4b/d
Antibody (16D2)

NB200-541

(12 Publications)

Species: Mu

Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB

NOD2 Antibody
(2D9) - BSA Free

NB100-524

Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free

(1 Review)

(26 Publications)

Species: Hu, Mu

Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...

NBP2-79843

Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free

Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

Publications for SI Sucrase-Isomaltase Partial Recombinant Protein (H00006476-Q01) (0)

There are no publications for SI Sucrase-Isomaltase Partial Recombinant Protein (H00006476-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SI Sucrase-Isomaltase Partial Recombinant Protein (H00006476-Q01) (0)

There are no reviews for SI Sucrase-Isomaltase Partial Recombinant Protein (H00006476-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SI Sucrase-Isomaltase Partial Recombinant Protein (H00006476-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SI Sucrase-Isomaltase Products

Blogs on SI Sucrase-Isomaltase

There are no specific blogs for SI Sucrase-Isomaltase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.

NOD2 Antibody (2D9) - BSA Free
NB100-524

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human SI Sucrase-Isomaltase GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human SI Sucrase-Isomaltase GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human SI Sucrase-Isomaltase GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human SI Sucrase-Isomaltase GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for SI Sucrase-Isomaltase Partial Recombinant Protein (H00006476-Q01) (0)

Reviews for SI Sucrase-Isomaltase Partial Recombinant Protein (H00006476-Q01) (0)

Product General Protocols

Video Protocols

FAQs for SI Sucrase-Isomaltase Partial Recombinant Protein (H00006476-Q01) (0)

Additional SI Sucrase-Isomaltase Products

Blogs on SI Sucrase-Isomaltase

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics