Home » Seipin/BSCL2 » BSCL2 Peptides and Proteins » Seipin/BSCL2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Seipin/BSCL2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Seipin/BSCL2 Protein (NBP1-81812PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Seipin/BSCL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BSCL2.

Source: E. coli

Amino Acid Sequence: PTVSHLSPVHFYYRTDCDSSTTSLCSFPVANVSLTKGGRDRVLMYGQPYRVTLELELPESPVNQDLGMFLVTISCYTR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BSCL2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81812.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Seipin/BSCL2 Recombinant Protein Antigen

  • Berardinelli-Seip congenital lipodystrophy 2 (seipin)
  • Bernardinelli-Seip congenital lipodystrophy 2 (seipin)
  • Bernardinelli-Seip congenital lipodystrophy type 2 protein
  • BSCL2
  • FLJ16651
  • GNG3LG
  • HMN5
  • MGC4694
  • Seipin
  • spastic paraplegia 17 (Silver syndrome)
  • SPG17

Background

BSCL2 - Bernardinelli-Seip congenital lipodystrophy 2 (seipin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AGPAT2 Antibody -
BSA Free
NBP2-92662
Western Blot AGPAT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence AGPAT2 Antibody - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Lamin A + C
Antibody (4C4)
NBP2-25151
Immunocytochemistry/ Immunofluorescence Lamin A + C Antibody (4C4)
Western Blot Lamin A + C Antibody (4C4)
Immunocytochemistry/ Immunofluorescence Lamin A + C Antibody (4C4)
(2 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, WB
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(155 Publications)
Species: Hu
Applications: ELISA
Caveolin-1
Antibody (7C8)
NB100-615
Flow Cytometry Caveolin-1 Antibody (7C8)
Flow Cytometry Caveolin-1 Antibody (7C8)
Immunocytochemistry/ Immunofluorescence Caveolin-1 Antibody (7C8)
(3 Reviews)
(37 Publications)
Species: Hu, Mu, Rt, Sh
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ZMPSTE24 Antibody
NB100-2388
Western Blot ZMPSTE24 Antibody
(1 Publication)
Species: Hu
Applications: WB
FoxC2 Antibody
AF6989
Immunohistochemistry FoxC2 Antibody
Immunohistochemistry FoxC2 Antibody
Immunohistochemistry FoxC2 Antibody
(27 Publications)
Species: Mu
Applications: IHC
GARS Antibody
NBP3-35329
Western Blot GARS Antibody
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
FMN1 Antibody (4F4)
H00342184-M07
ELISA FMN1 Antibody (4F4)
Immunocytochemistry/ Immunofluorescence FMN1 Antibody (4F4)
Western Blot FMN1 Antibody (4F4)
Species: Hu
Applications: ELISA, ICC/IF, WB
Granzyme H
Antibody [Unconjugate
AF1377
Immunocytochemistry Granzyme H Antibody [Unconjugated]
Species: Hu
Applications: ICC, IP, WB
Kinesin 5A
Antibody - BSA Free
NBP1-76816
Immunohistochemistry Kinesin 5A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Kinesin 5A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Kinesin 5A Antibody - BSA Free
(1 Review)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
AKT2 Antibody
[Unconjugated]
AF23151
Western Blot AKT2 Antibody [Unconjugated]
Immunohistochemistry AKT2 Antibody [Unconjugated]
Immunohistochemistry AKT2 Antibody [Unconjugated]
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Spastin Antibody
(2F5)
H00006683-M02
Immunocytochemistry/ Immunofluorescence Spastin Antibody (2F5)
Western Blot Spastin Antibody (2F5)
Immunohistochemistry-Paraffin Spastin Antibody (2F5)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Insulin Receptor
beta Antibody
NBP2-12793
Immunohistochemistry-Paraffin Insulin Receptor beta Antibody
Immunoprecipitation Insulin Receptor beta Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
HSP27 Antibody
(G3.1)
NBP2-32972
Flow Cytometry HSP27 Antibody (G3.1)
Western Blot HSP27 Antibody (G3.1)
Immunocytochemistry/ Immunofluorescence HSP27 Antibody (G3.1)
(1 Review)
(5 Publications)
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
HSPB8/HSP22
Antibody (520817) [Un ...
MAB4987
Western Blot HSPB8/HSP22 Antibody (520817) [Unconjugated]
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB
GART Antibody
(4D6-1D5)
H00002618-M01
Western Blot GART Antibody (4D6-1D5)
Western Blot GART Antibody (4D6-1D5)
Western Blot GART Antibody (4D6-1D5)
(9 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, PLA, WB
GJC2 Antibody
NBP1-59263
Immunohistochemistry GJC2 Antibody
Western Blot GJC2 Antibody
Immunohistochemistry GJC2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Seipin/BSCL2
Recombinant Protein A ...
NBP1-81812PEP
Seipin/BSCL2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Seipin/BSCL2 Protein (NBP1-81812PEP) (0)

There are no publications for Seipin/BSCL2 Protein (NBP1-81812PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Seipin/BSCL2 Protein (NBP1-81812PEP) (0)

There are no reviews for Seipin/BSCL2 Protein (NBP1-81812PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Seipin/BSCL2 Protein (NBP1-81812PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Seipin/BSCL2 Products

Blogs on Seipin/BSCL2

There are no specific blogs for Seipin/BSCL2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: Caveolin-1 Antibody (7C8) [NB100-615] - An intracellular stain was performed on HeLa cells with Caveolin-1 Antibody (7C8) NB100-615 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
Caveolin-1 Antibody (7C8)
NB100-615

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Seipin/BSCL2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol BSCL2