Home » RHOXF2 » RHOXF2 Proteins » RHOXF2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

RHOXF2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RHOXF2 Protein (NBP1-84364PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RHOXF2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RHOXF2.

Source: E. coli

Amino Acid Sequence: DQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEVKEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGGGEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQSEKEPGQQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RHOXF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84364.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RHOXF2 Recombinant Protein Antigen

  • CT107
  • Paired-like homeobox protein PEPP-2
  • PEPP subfamily gene 2
  • PEPP-2
  • PEPP2cancer/testis antigen 107
  • rhox homeobox family member 2
  • Rhox homeobox family, member 2
  • Testis homeobox gene 1
  • THG1homeobox protein from AL590526

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-3 [Unconjugated]
203-IL
SDS-PAGE IL-3 [Unconjugated]
Bioactivity IL-3 [Unconjugated]
SEC-MALS IL-3 [Unconjugated]
(216 Publications)
Species: Hu
Applications: BA
RHOXF1 Antibody
(4D12)
H00158800-M01
Immunocytochemistry/ Immunofluorescence RHOXF1 Antibody (4D12)
Western Blot RHOXF1 Antibody (4D12)
Sandwich ELISA RHOXF1 Antibody (4D12)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
HARS Antibody
NBP1-89490
Immunocytochemistry/ Immunofluorescence HARS Antibody
Immunohistochemistry-Paraffin HARS Antibody
Immunohistochemistry-Paraffin HARS Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
MYD118 Antibody
NBP3-12326
Western Blot MYD118 Antibody
Immunohistochemistry-Paraffin MYD118 Antibody
Immunohistochemistry-Paraffin MYD118 Antibody
Species: Hu, Mu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Recombinant Human
ERAS GST (N-Term) Pro ...
H00003266-P01
Other Recombinant Human ERAS GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
DNMT1 Antibody
(60B1220.1) - BSA Fre
NB100-56519
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Immunoprecipitation DNMT1 Antibody (60B1220.1) - BSA Free
(4 Reviews)
(144 Publications)
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
PLEKHA4 Antibody
NBP2-47331
Immunocytochemistry/ Immunofluorescence PLEKHA4 Antibody
Immunohistochemistry-Paraffin PLEKHA4 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PIM3 Antibody
NBP3-42026
PIM3 Antibody
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Immunocytochemistry/ Immunofluorescence Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Oct-3/4 Antibody
[Unconjugated]
AF1759
Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]
Immunocytochemistry Oct-3/4 Antibody [Unconjugated]
Simple Western Oct-3/4 Antibody [Unconjugated]
(77 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Contactin-1
Antibody [Unconjugate
AF904
Western Blot Contactin-1 Antibody [Unconjugated]
Immunohistochemistry Contactin-1 Antibody [Unconjugated]
Neutralization Contactin-1 Antibody [Unconjugated]
(21 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
Netrin-1
[Unconjugated]
1109-N1
SDS-PAGE Netrin-1 [Unconjugated]
(41 Publications)
Species: Mu
Applications: Bind
p15INK4b/CDKN2B
Antibody (OTI3B6)
NBP2-45603
Flow Cytometry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Immunohistochemistry p15INK4b/CDKN2B Antibody (OTI3B6)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
TTF2 Antibody (1E8)
H00008458-M06
Immunocytochemistry/ Immunofluorescence TTF2 Antibody (1E8)
Western Blot TTF2 Antibody (1E8)
Western Blot TTF2 Antibody (1E8)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
OTOA Antibody
NBP1-84363
Immunohistochemistry-Paraffin OTOA Antibody
Species: Hu
Applications: IHC, IHC-P
UNC5H3/UNC5C
Antibody (200414) [Un ...
MAB1005
Immunohistochemistry UNC5H3/UNC5C Antibody (200414) [Unconjugated]
(3 Publications)
Species: Hu
Applications: IHC, WB

Publications for RHOXF2 Protein (NBP1-84364PEP) (0)

There are no publications for RHOXF2 Protein (NBP1-84364PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RHOXF2 Protein (NBP1-84364PEP) (0)

There are no reviews for RHOXF2 Protein (NBP1-84364PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RHOXF2 Protein (NBP1-84364PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RHOXF2 Products

Blogs on RHOXF2

There are no specific blogs for RHOXF2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: DNMT1 Antibody (60B1220.1) [NB100-56519] - Analysis of PE conjugate of NB100-56519. An intracellular stain was performed on HeLa cells with DNMT1 antibody (60B1220.1) NB100-56519PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0
DNMT1 Antibody (60B1220.1) - BSA Free
NB100-56519

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RHOXF2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RHOXF2