Home » RBM5 » RBM5 Proteins » RBM5 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

RBM5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for RBM5 Protein (NBP1-83305PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RBM5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RBM5.

Source: E. coli

Amino Acid Sequence: WSSTQSQSGEGGSVDYSYLQPGQDGYAQYAQYSQDYQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQSPQLYNQTSNPPGSPTEEAQPSTSTSTQAPAASPTGVVPGTKYAVPDTSTYQYDESSGYYY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RBM5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83305.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RBM5 Recombinant Protein Antigen

  • G15
  • H37
  • LUCA15FLJ39876
  • Protein G15
  • Putative tumor suppressor LUCA15
  • Renal carcinoma antigen NY-REN-9
  • RMB5
  • RNA binding motif protein 5
  • RNA-binding motif protein 5
  • RNA-binding protein 5

Background

RNA-binding motif protein 5 (RBM5) is also known as LUCA-15. The RBM5 gene is located within a region highly susceptible to deletions in lung cancer and is implicated to be a tumor suppressor. RBM5 bears two RRM domains, one RanBP2-type zinc finger, one C2H2-type zinc finger, and a G-patch domain. It has been found to be a component of the spliceosome, a complex that regulates alternative splicing and is involved in the regulation of proliferation and apoptosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GPER/GPR30
Antibody [Unconjugate
AF5534
Western Blot GPER/GPR30 Antibody [Unconjugated]
Immunohistochemistry GPER/GPR30 Antibody [Unconjugated]
Flow Cytometry GPER/GPR30 Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: Flow, IHC, WB
RBM6 Antibody
NBP1-89377
Immunohistochemistry-Paraffin RBM6 Antibody
Immunohistochemistry-Paraffin RBM6 Antibody
Immunohistochemistry-Paraffin RBM6 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
BUD31 Antibody
NBP1-84010
Western Blot BUD31 Antibody
Immunohistochemistry-Paraffin BUD31 Antibody
Immunocytochemistry/ Immunofluorescence BUD31 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ZBTB12 Antibody
H00221527-B01P
Immunocytochemistry/ Immunofluorescence ZBTB12 Antibody
Western Blot ZBTB12 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
CISH/CIS-1
Antibody [Unconjugate
AF3194
Western Blot CISH/CIS-1 Antibody [Unconjugated]
Immunocytochemistry CISH/CIS-1 Antibody [Unconjugated]
Simple Western CISH/CIS-1 Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(813 Publications)
Species: Hu
Applications: BA
Recombinant Human
GPSM3 GST (N-Term) Pr ...
H00063940-P01
Other Recombinant Human GPSM3 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
ER alpha/NR3A1
Antibody (33)
NB300-560
Western Blot ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Frozen ER alpha/NR3A1 Antibody (33)
Immunohistochemistry-Paraffin ER alpha/NR3A1 Antibody (33)
(1 Review)
(10 Publications)
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Fas/TNFRSF6/CD95
Antibody - BSA Free
NB120-13550
Immunocytochemistry/ Immunofluorescence Fas/TNFRSF6/CD95 Antibody - BSA Free
Western Blot Fas/TNFRSF6/CD95 Antibody - BSA Free
Immunohistochemistry-Paraffin Fas/TNFRSF6/CD95 Antibody - BSA Free
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ATF6 beta Antibody
(4D10)
H00001388-M02
Sandwich ELISA ATF6 beta Antibody (4D10)
Immunocytochemistry/ Immunofluorescence ATF6 beta Antibody (4D10)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
TSG Antibody
[Unconjugated]
AF756
Immunohistochemistry TSG Antibody [Unconjugated]
Immunohistochemistry TSG Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: IHC, WB
RNF5 Antibody -
BSA Free
NBP2-94913
Immunohistochemistry-Paraffin RNF5 Antibody - BSA Free
Immunohistochemistry-Paraffin RNF5 Antibody - BSA Free
Western Blot RNF5 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
G protein alpha-13
Antibody
NBP3-12983
Immunohistochemistry-Paraffin G protein alpha-13 Antibody
Immunohistochemistry-Paraffin G protein alpha-13 Antibody
Western Blot G protein alpha-13 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
RBM10 Antibody
NBP1-84951
Immunocytochemistry/ Immunofluorescence RBM10 Antibody
Immunohistochemistry-Paraffin RBM10 Antibody
Immunohistochemistry-Paraffin RBM10 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Recombinant Human
PPT2 GST (N-Term) Pro ...
H00009374-P01
Other Recombinant Human PPT2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
BAT3/BAG6 Antibody
AF6438
Immunocytochemistry BAT3/BAG6 Antibody
Western Blot BAT3/BAG6 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
GLS2 Antibody -
BSA Free
NBP1-76544
Western Blot GLS2 Antibody - BSA Free
Immunohistochemistry GLS2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GLS2 Antibody - BSA Free
(7 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB

Publications for RBM5 Protein (NBP1-83305PEP) (0)

There are no publications for RBM5 Protein (NBP1-83305PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBM5 Protein (NBP1-83305PEP) (0)

There are no reviews for RBM5 Protein (NBP1-83305PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RBM5 Protein (NBP1-83305PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RBM5 Products

Blogs on RBM5

There are no specific blogs for RBM5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RBM5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol RBM5