![Western Blot: PNPLA6 Antibody (3D10) [H00010908-M08] - Analysis of PNPLA6 expression in transfected 293T cell line by NTE monoclonal antibody (M08), clone 3D10. Lane 1: PNPLA6 transfected lysate (Predicted MW: 146.2 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PNPLA6-Antibody-3D10-Western-Blot-H00010908-M08-img0003.jpg "Western Blot: PNPLA6 Antibody (3D10) [H00010908-M08] - Analysis of PNPLA6 expression in transfected 293T cell line by NTE monoclonal antibody (M08), clone 3D10. Lane 1: PNPLA6 transfected lysate (Predicted MW: 146.2 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 3D10 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | NTE (NP_006693.2, 1229 a.a. ~ 1327 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESRRADVLAFPSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGPDCSRDEGGSPEGASPSTASEMEEEKSILRQRRCLPQEPPGSATDA |
| Specificity | NTE - neuropathy target esterase (3D10) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PNPLA6 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: PNPLA6 Antibody (3D10) [H00010908-M08] - Analysis of monoclonal antibody to PNPLA6 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml](http://images.novusbio.com/fullsize/PNPLA6-Antibody-3D10-Immunohistochemistry-Paraffin-H00010908-M08-img0001.jpg "Immunohistochemistry-Paraffin: PNPLA6 Antibody (3D10) [H00010908-M08] - Analysis of monoclonal antibody to PNPLA6 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml")
![Sandwich ELISA: PNPLA6 Antibody (3D10) [H00010908-M08] - Detection limit for recombinant GST tagged PNPLA6 is 1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/PNPLA6-Antibody-3D10-Sandwich-ELISA-H00010908-M08-img0002.jpg "Sandwich ELISA: PNPLA6 Antibody (3D10) [H00010908-M08] - Detection limit for recombinant GST tagged PNPLA6 is 1 ng/ml as a capture antibody.")
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
