![Western Blot: PBX2 Antibody [NBP2-31853] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/PBX2-Antibody-Western-Blot-NBP2-31853-img0004.jpg "Western Blot: PBX2 Antibody [NBP2-31853] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMRANGSW |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PBX2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PBX2 Antibody [NBP2-31853] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/PBX2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-31853-img0006.jpg "Immunocytochemistry/Immunofluorescence: PBX2 Antibody [NBP2-31853] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0015.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human nasopharynx shows strong nuclear positivity in respiratory epithelial cells.](http://images.novusbio.com/fullsize/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0007.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human nasopharynx shows strong nuclear positivity in respiratory epithelial cells.")
![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human epididymis shows high expression.](http://images.novusbio.com/fullsize/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0008.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human epididymis shows high expression.")
![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0009.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Analysis in human epididymis and liver tissues using NBP2-31853 antibody. Corresponding PBX2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0011.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Analysis in human epididymis and liver tissues using NBP2-31853 antibody. Corresponding PBX2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human epididymis shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0012.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human epididymis shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0013.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human cervix shows moderate nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0014.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human cervix shows moderate nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/PBX2-Antibody-Immunohistochemistry-Paraffin-NBP2-31853-img0016.jpg "Immunohistochemistry-Paraffin: PBX2 Antibody [NBP2-31853] - Staining of human liver shows no positivity in hepatocytes as expected.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Immunocytochemistry Notch-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3847_human-notch-4-intracellular-domain-affinity-purified-pab-immunocytochemistry-3092021102949.jpg)
![N/A AGER [HRP]](https://images.novusbio.com/images2/DATA_RAGE_DRG00_ELISA_806.jpg)
![N/A AGER [HRP]](https://images.novusbio.com/images2/DATA_RAGE_DRG00_ELISA_807.jpg)
![N/A AGER [HRP]](https://images.novusbio.com/images2/RAGE_DRG00_ELISA_171.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")