Novus Biologicals products are now on bio-techne.com

NT5M Recombinant Protein Antigen

Name: NT5M Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-92203PEP
Price: 279 USD

Images

There are currently no images for NT5M Protein (NBP1-92203PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NT5M Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NT5M. Source: E. coli Amino Acid Sequence: FELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCPYEKYAWVEKYFGPDFLEQIVLTRDKT Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	NT5M
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92203. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NT5M Recombinant Protein Antigen

3'-nucleotidase, mitochondrialDNT2
5' nucleotidase, mitochondrial
5'
5(3)-deoxyribonucleotidase
Deoxy-5'-nucleotidase 2
dNT2
dNT-25'(3')-deoxyribonucleotidase, mitochondrial
EC 3.1.3
EC 3.1.3.-
mdN
mitochondrial 5' nucleotidase

Background

NT5M encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Prostatic Acid
Phosphatase/ACPP Anti ...

AF6240

Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]

ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]

(1 Publication)

Species: Hu

Applications: ELISA, IHC, WB

5'-Nucleotidase/CD73 A ...

NBP2-48480

Flow Cytometry 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free

(1 Review)

(15 Publications)

Species: Hu

Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P

NT5C Antibody

NBP1-84563

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB

PD-ECGF/Thymidine
Phosphorylase Antibod ...

NB100-2737

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IP, WB

Thymidine Kinase 1
Antibody

NBP2-20626

Western Blot Thymidine Kinase 1 Antibody

(1 Publication)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, KO, WB

SLC25A19 Antibody
- Azide and BSA Free

NBP2-94007

Immunocytochemistry/ Immunofluorescence SLC25A19 Antibody - Azide and BSA Free

Species: Hu, Mu

Applications: ICC/IF, WB

Exosome component
6 Antibody

NBP1-57508

Immunohistochemistry-Paraffin Exosome component 6 Antibody

Species: Hu

Applications: IHC, IHC-P, WB

Thymidine Kinase 2
Antibody

NBP1-92505

(1 Publication)

Species: Hu

Applications: IHC, IHC-P

P11 Antibody

NBP1-82458

Species: Hu

Applications: IHC, IHC-P

S100A10 Antibody
[Unconjugated]

AF2377

Immunohistochemistry S100A10 Antibody [Unconjugated]

Simple Western S100A10 Antibody [Unconjugated]

(22 Publications)

Species: Mu

Applications: IHC, Simple Western, WB

RAI1 Antibody

NBP1-28745

Immunohistochemistry-Paraffin RAI1 Antibody

Species: Hu

Applications: IHC, IHC-P, IP, WB

Spermine synthase
Antibody (OTI3C9)

NBP2-00900

Flow Cytometry Spermine synthase Antibody (OTI3C9)

Species: Ca, Hu, Pm, Mu, Pm, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

Thymopoietin/LAP2
Antibody

NBP1-87822

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

TSPAN33 Antibody
(8A2A9)

NBP3-27168

Immunohistochemistry TSPAN33 Antibody (8A2A9)

Species: Hu

Applications: ELISA, Flow, IHC, IHC-P, WB

14-3-3 epsilon
Antibody

NBP1-89827

(1 Review)

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Gigaxonin Antibody

NBP1-49924

(1 Publication)

Species: Hu

Applications: ICC/IF, IP, WB

DCK Antibody
(10412)

NBP2-43639

Immunocytochemistry/ Immunofluorescence DCK Antibody (10412)

(1 Review)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, IP, WB

BDNF [HRP]

DBD00

(104 Publications)

Species: Hu

Applications: ELISA

SAP155 Antibody
(4A3G9)

NBP3-33555

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Carnosine
Dipeptidase 1/CNDP1 A

NBP1-85528

(6 Publications)

Species: Hu

Applications: IHC, IHC-P

Publications for NT5M Protein (NBP1-92203PEP) (0)

There are no publications for NT5M Protein (NBP1-92203PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NT5M Protein (NBP1-92203PEP) (0)

There are no reviews for NT5M Protein (NBP1-92203PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NT5M Protein (NBP1-92203PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NT5M Products

Research Areas for NT5M Protein (NBP1-92203PEP)

Find related products by research area.

Lipid and Metabolism

Blogs on NT5M

There are no specific blogs for NT5M, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow (Cell Surface): 5'-Nucleotidase/CD73 Antibody (AD2) [NBP2-48480] - A surface stain was performed on U87 MG cells with 5'-Nucleotidase/CD73 Antibody (AD2) antibody NBP2-48480 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature, followed by Dylight488-conjugated anti-mouse secondary antibody.

5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
NBP2-48480

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our NT5M Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

NT5M

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

NT5M Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

NT5M Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for NT5M Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for NT5M Protein (NBP1-92203PEP) (0)

Reviews for NT5M Protein (NBP1-92203PEP) (0)

FAQs for NT5M Protein (NBP1-92203PEP) (0)

Additional NT5M Products

Research Areas for NT5M Protein (NBP1-92203PEP)

Blogs on NT5M

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics