![Western Blot: NEK10 Antibody (1C9) [H00152110-M01] - NEK10 monoclonal antibody (M01), clone 1C9. Analysis of NEK10 expression in NIH/3T3.](http://images.novusbio.com/fullsize/NEK10-Antibody-1C9-Western-Blot-H00152110-M01-img0012.jpg "Western Blot: NEK10 Antibody (1C9) [H00152110-M01] - NEK10 monoclonal antibody (M01), clone 1C9. Analysis of NEK10 expression in NIH/3T3.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 1C9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | NEK10 (NP_689747, 211 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RYFMEANRNTVTCHHELAVLSHETFEKASLSSSSSGAASLKSELSESADLPPEGFQASYGKDEDRACDEILSDDNFNLENAEKDTYSEVD |
| Specificity | NEK10 - NIMA (never in mitosis gene a)- related kinase 10 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | NEK10 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NEK10 Antibody (H00152110-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: NEK10 Antibody (1C9) [H00152110-M01] - Analysis of monoclonal antibody to NEK10 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/NEK10-Antibody-1C9-Immunocytochemistry-Immunofluorescence-H00152110-M01-img0008.jpg "Immunocytochemistry/Immunofluorescence: NEK10 Antibody (1C9) [H00152110-M01] - Analysis of monoclonal antibody to NEK10 on HeLa cell. Antibody concentration 10 ug/ml.")
![Western Blot: NEK10 Antibody (1C9) [H00152110-M01] - NEK10 monoclonal antibody (M01), clone 1C9 Analysis of NEK10 expression in HeLa.](http://images.novusbio.com/fullsize/NEK10-Antibody-1C9-Western-Blot-H00152110-M01-img0010.jpg "Western Blot: NEK10 Antibody (1C9) [H00152110-M01] - NEK10 monoclonal antibody (M01), clone 1C9 Analysis of NEK10 expression in HeLa.")
![Western Blot: NEK10 Antibody (1C9) [H00152110-M01] - NEK10 monoclonal antibody (M01), clone 1C9. Analysis of NEK10 expression in Raw 264.7.](http://images.novusbio.com/fullsize/NEK10-Antibody-1C9-Western-Blot-H00152110-M01-img0011.jpg "Western Blot: NEK10 Antibody (1C9) [H00152110-M01] - NEK10 monoclonal antibody (M01), clone 1C9. Analysis of NEK10 expression in Raw 264.7.")
![Western Blot: NEK10 Antibody (1C9) [H00152110-M01] - Analysis of NEK10 expression in transfected 293T cell line by NEK10 monoclonal antibody (M01), clone 1C9.Lane 1: NEK10 transfected lysate(53.1 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/NEK10-Antibody-1C9-Western-Blot-H00152110-M01-img0013.jpg "Western Blot: NEK10 Antibody (1C9) [H00152110-M01] - Analysis of NEK10 expression in transfected 293T cell line by NEK10 monoclonal antibody (M01), clone 1C9.Lane 1: NEK10 transfected lysate(53.1 KDa).Lane 2: Non-transfected lysate.")
![Sandwich ELISA: NEK10 Antibody (1C9) [H00152110-M01] - Detection limit for recombinant GST tagged NEK10 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/NEK10-Antibody-1C9-Sandwich-ELISA-H00152110-M01-img0009.jpg "Sandwich ELISA: NEK10 Antibody (1C9) [H00152110-M01] - Detection limit for recombinant GST tagged NEK10 is approximately 0.03ng/ml as a capture antibody.")
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Immunocytochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunocytochemistry__Immunofluorescence_20674.jpg)
![Immunohistochemistry Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Immunohistochemistry_20779.jpg)
![Western Blot Progesterone R/NR3C3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Progesterone_R_AF5415_Western_Blot_5715.jpg)
![Western Blot Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Western_Blot_9426.jpg)
![Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Immunohistochemistry_9891.jpg)
![Simple Western Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/mab4540_human-mouse-rat-raf-1-mab-clone-563002-simple-western-158202212919.jpg)
