Novus Biologicals products are now on bio-techne.com

Ndufs1 Recombinant Protein Antigen

Name: Ndufs1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-56504PEP
Price: 279 USD

Images

There are currently no images for Ndufs1 Recombinant Protein Antigen (NBP2-56504PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Ndufs1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Ndufs1. Source: E. coli Amino Acid Sequence: REDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAV Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	NDUFS1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56504. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Ndufs1 Recombinant Protein Antigen

CI-75k
CI-75kD
complex I 75kDa subunit
complex I, mitochondrial respiratory chain, 75-kD subunit
Complex I-75kD
EC 1.6.5.3
EC 1.6.99.3
EC 7.1.1.2
MGC26839
mitochondrial NADH-ubiquinone oxidoreductase 75 kDa subunit
NADH dehydrogenase (ubiquinone) Fe-S protein 1 (75kD) (NADH-coenzyme Qreductase)
NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Qreductase)
NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
Ndufs1
PRO1304

Background

Ndufs1 is encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NDUFV1 Antibody

NBP1-33074

Immunohistochemistry-Paraffin NDUFV1 Antibody

(1 Publication)

Species: Hu, Mu, Ze

Applications: IHC, IHC-P, KO, WB

Ndufs4 Antibody

NBP1-89026

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

NDUFS7 Antibody

NBP1-49846

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, PEP-ELISA, WB

NDUFS2 Antibody
(OTI1D5)

NBP2-46127

Immunohistochemistry NDUFS2 Antibody (OTI1D5)

(1 Publication)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, KO, WB

NDUFS8 Antibody

NBP1-85620

Immunocytochemistry/ Immunofluorescence NDUFS8 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

NDUFS3 Antibody
(1D6)

H00004722-M02

Immunohistochemistry-Paraffin NDUFS3 Antibody (1D6)

Immunoprecipitation NDUFS3 Antibody (1D6)

(1 Publication)

Species: Hu

Applications: ELISA, IHC, IHC-P, IP, KD, WB

NDUFV2 Antibody

NBP1-84475

(3 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, WB

NDUFB6 Antibody

NBP1-92172

Immunocytochemistry/ Immunofluorescence NDUFB6 Antibody

(2 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

UQCRH Antibody

NBP1-93442

(1 Review)

Species: Hu

Applications: IHC, IHC-P

Cytochrome c
Antibody (7H8.2C12) - ...

NB100-56503

Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free

Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free

(61 Publications)

Species: Dr, Hu, Mu, Rb, Rt

Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB

UQCRC2 Antibody

NBP1-80861

Immunohistochemistry-Paraffin UQCRC2 Antibody

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

Norrin/NDP
Antibody [Unconjugate

AF3014

(6 Publications)

Species: Hu

Applications: Block, IHC, WB

NDUFA8 Antibody

NBP1-82661

Immunohistochemistry-Paraffin NDUFA8 Antibody

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

NDUFAB1 Antibody

NBP2-33710

Immunocytochemistry/ Immunofluorescence NDUFAB1 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

alpha-Synuclein
Antibody

NBP2-15365

Immunocytochemistry/ Immunofluorescence alpha-Synuclein Antibody

(1 Review)

(12 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB

NDUFS6 Antibody

NBP1-49831

Immunohistochemistry-Paraffin NDUFS6 Antibody

(1 Publication)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, PEP-ELISA, WB

Kallikrein 3/PSA
[HRP]

DKK300

(17 Publications)

Species: Hu

Applications: ELISA

TXNL1 Antibody

NBP1-86899

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

hnRNP C1 + C2
Antibody (CL2593)

NBP2-36776

Immunohistochemistry hnRNP C1 + C2 Antibody (CL2593)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, WB

MT-ND5 Antibody -
BSA Free

NBP3-05606

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

Publications for Ndufs1 Recombinant Protein Antigen (NBP2-56504PEP) (0)

There are no publications for Ndufs1 Recombinant Protein Antigen (NBP2-56504PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ndufs1 Recombinant Protein Antigen (NBP2-56504PEP) (0)

There are no reviews for Ndufs1 Recombinant Protein Antigen (NBP2-56504PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Ndufs1 Recombinant Protein Antigen (NBP2-56504PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ndufs1 Products

Research Areas for Ndufs1 Recombinant Protein Antigen (NBP2-56504PEP)

Find related products by research area.

Vision

Blogs on Ndufs1

There are no specific blogs for Ndufs1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

alpha-Synuclein Antibody
NBP2-15365

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our Ndufs1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

NDUFS1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Ndufs1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

Ndufs1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for Ndufs1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Ndufs1 Recombinant Protein Antigen (NBP2-56504PEP) (0)

Reviews for Ndufs1 Recombinant Protein Antigen (NBP2-56504PEP) (0)

FAQs for Ndufs1 Recombinant Protein Antigen (NBP2-56504PEP) (0)

Additional Ndufs1 Products

Research Areas for Ndufs1 Recombinant Protein Antigen (NBP2-56504PEP)

Blogs on Ndufs1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics