![Western Blot: MX2 Antibody [NBP1-81018] - MX2 is localized to mitochondria in cultured cells. Western blotting of four distinct cell lines comparing endogenous MX2 expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha-2alpha. HeLa, Hep3B and HepG2 cells induced MX2 expression by IFN treatment, but not Huh7 cells. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-020-14727-w), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/MX2-Antibody-Western-Blot-NBP1-81018-img0008.jpg "Western Blot: MX2 Antibody [NBP1-81018] - MX2 is localized to mitochondria in cultured cells. Western blotting of four distinct cell lines comparing endogenous MX2 expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha-2alpha. HeLa, Hep3B and HepG2 cells induced MX2 expression by IFN treatment, but not Huh7 cells. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-020-14727-w), licensed under a CC-BY license.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLAKDFNFLTLNNQPPPGNRSQPRAMG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MX2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 82 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 01/31/2020 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for MX2 Antibody (NBP1-81018)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human spleen shows strong positivity in nuclear membrane in cells in red pulp.](http://images.novusbio.com/fullsize/MX2-Antibody-Immunohistochemistry-Paraffin-NBP1-81018-img0005.jpg "Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human spleen shows strong positivity in nuclear membrane in cells in red pulp.")
![Western Blot: MX2 Antibody [NBP1-81018] - Human glioma U87 cell lysate. WB image submitted by a verified customer review.](http://images.novusbio.com/fullsize/MX2-Antibody-Western-Blot-NBP1-81018-img0006.jpg "Western Blot: MX2 Antibody [NBP1-81018] - Human glioma U87 cell lysate. WB image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human liver shows no postivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/MX2-Antibody-Immunohistochemistry-Paraffin-NBP1-81018-img0001.jpg "Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human liver shows no postivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human colon shows moderate postivity in nuclear membrane in lymphoid cells in the lamina propria.](http://images.novusbio.com/fullsize/MX2-Antibody-Immunohistochemistry-Paraffin-NBP1-81018-img0002.jpg "Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human colon shows moderate postivity in nuclear membrane in lymphoid cells in the lamina propria.")
![Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human skeletal muscle shows no postivity in myocytes as expected.](http://images.novusbio.com/fullsize/MX2-Antibody-Immunohistochemistry-Paraffin-NBP1-81018-img0003.jpg "Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human skeletal muscle shows no postivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human lymph node shows moderate positivity in nuclear membrane in non-germinal center cells.](http://images.novusbio.com/fullsize/MX2-Antibody-Immunohistochemistry-Paraffin-NBP1-81018-img0004.jpg "Immunohistochemistry-Paraffin: MX2 Antibody [NBP1-81018] - Staining of human lymph node shows moderate positivity in nuclear membrane in non-germinal center cells.")
![Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81018_rabbit-polyclonal-mx2-antibody-31020241618913.jpg "Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81018_rabbit-polyclonal-mx2-antibody-310202416161823.jpg "Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81018_rabbit-polyclonal-mx2-antibody-310202416154637.jpg "Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-81018_rabbit-polyclonal-mx2-antibody-310202416163747.jpg "Western Blot: MX2 Antibody [NBP1-81018] - MxB is localized to mitochondria in cultured cells.Fluorescence images of Hep3B cells or HeLa cells, stained with a polyclonal antibody (IJ-GP) to MxB (a, c), or expressing exogenous human MxB-GFP (b, d). All cells were stained for the inner mitochondrial membrane marker CoxIV. MxB is visualized as small or large puncta that align closely with mitochondrial membranes. Boxed regions provide a higher magnification for color overlays showing the alignment of MxB (green) with mitochondria (red) in both cell types. Scale bars, 10 μm. e Western blot analysis of different human tissues (Br = brain, Lng = lung, Liv = liver, LN = lymph node, SP = spleen, Tst = testis, Tns = tonsil) for endogenous MxB that appears enriched in the liver, lymph node, testis, tonsil, & pig liver. f Western blotting comparing MxB expression in HeLa cells, three different hepatocyte cell lines, & a human monocyte cell line (THP-1), as well as primary human & pig hepatocytes. Expression levels are exceptionally high in primary hepatocytes, the HepG2 & Huh7 cell lines (H3B = Hep3B, HG2 = HepG2, Hu7 = Huh7, THP = THP-1, Hu = human hepatocytes). g Western blotting of four distinct cell lines comparing endogenous MxB expression under control conditions vs. treatment with 1,000 IU/ ml-1 of IFN-alpha −2Α. HeLa, Hep3B & HepG2 cells induced MxB expression by IFN treatment, but not Huh7 cells. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32102993), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Immunocytochemistry__Immunofluorescence_19196.jpg)
![Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2_MAB1233_Flow_Cytometry_19476.jpg)
![Immunohistochemistry Adrenomedullin/ADM Antibody [Unconjugated]](https://images.novusbio.com/images2/Adrenomedullin_AF6108_Immunohistochemistry_9966.jpg)
![ISG15/UCRP [7-Amino-4-Methyl Coumarin]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "ISG15/UCRP [7-Amino-4-Methyl Coumarin]")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
