Home » Morg1 » Morg1 Proteins » Morg1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Morg1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Morg1 Protein (NBP1-92133PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Morg1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WDR83.

Source: E. coli

Amino Acid Sequence: CLSERDTHVVSCSEDGKVFFWDLVEGALALALPVGSGVVQSLAYHPTEPCLLTAMGGSVQCWREEAYEAEDGAG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
WDR83
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92133.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Morg1 Recombinant Protein Antigen

  • MAPK organizer 1
  • MGC4238
  • MORG1Mitogen-activated protein kinase organizer 1
  • WD repeat domain 83
  • WD repeat domain-containing protein 83

Background

Mitogen-activated protein kinase organiser 1 (Morg1) is a scaffold protein for various multimeric complexes. It stabilises the assembly of several important components of the ERK pathway including Raf-1 and MEK into an oligomeric complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

EGLN3/PHD3
Antibody - BSA Free
NB100-139
Knockdown Validated EGLN3/PHD3 Antibody - BSA Free
Knockdown Validated EGLN3/PHD3 Antibody - BSA Free
Western Blot EGLN3/PHD3 Antibody - BSA Free
(2 Reviews)
(53 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, EM, ICC/IF, IHC, IHC-P, IP, KD, MS, WB
HIF-1 alpha
Antibody (H1alpha67)
NB100-105
Western Blot HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
(45 Reviews)
(1043 Publications)
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
Erythropoietin/EPO
[HRP]
MEP00B
N/A Erythropoietin/EPO [HRP]
N/A Erythropoietin/EPO [HRP]
(105 Publications)
Species: Mu
Applications: ELISA
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Angiogenin [HRP]
DAN00
N/A Angiogenin [HRP]
N/A Angiogenin [HRP]
(23 Publications)
Species: Hu
Applications: ELISA
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(684 Publications)
Species: Hu
Applications: ELISA
MP1/MAP2K1IP1
Antibody - BSA Free
NBP1-50631
Immunocytochemistry/ Immunofluorescence MP1/MAP2K1IP1 Antibody - BSA Free
Western Blot MP1/MAP2K1IP1 Antibody - BSA Free
Immunohistochemistry MP1/MAP2K1IP1 Antibody - BSA Free
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
CXCL10/IP-10/CRG-2
[HRP]
DIP100
N/A CXCL10/IP-10/CRG-2 [HRP]
N/A CXCL10/IP-10/CRG-2 [HRP]
N/A CXCL10/IP-10/CRG-2 [HRP]
(155 Publications)
Species: Hu
Applications: ELISA
Methionine
Aminopeptidase 2/META ...
NBP3-05513
Immunocytochemistry/ Immunofluorescence Methionine Aminopeptidase 2/METAP2 Antibody
Immunohistochemistry-Paraffin Methionine Aminopeptidase 2/METAP2 Antibody
Western Blot Methionine Aminopeptidase 2/METAP2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Raf-1 Antibody
(563002) [Unconjugate
MAB4540
Western Blot Raf-1 Antibody (563002) [Unconjugated]
Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]
Simple Western Raf-1 Antibody (563002) [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
DHPS Antibody
NBP1-82648
Immunocytochemistry/ Immunofluorescence DHPS Antibody
Western Blot DHPS Antibody
Immunohistochemistry-Paraffin DHPS Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
POMT1 Antibody
NBP3-12487
Immunohistochemistry-Paraffin POMT1 Antibody
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
PITRM1 Antibody
NBP1-81729
Immunohistochemistry-Paraffin PITRM1 Antibody
Immunohistochemistry-Paraffin PITRM1 Antibody
Immunohistochemistry-Paraffin PITRM1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
EPX Antibody
(rEPO104)
NBP3-07388
Immunohistochemistry-Paraffin EPX Antibody (rEPO104)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
TrkA Antibody
[Unconjugated]
AF1056
Immunohistochemistry TrkA Antibody [Unconjugated]
Western Blot TrkA Antibody [Unconjugated]
Immunohistochemistry TrkA Antibody [Unconjugated]
(44 Publications)
Species: Rt
Applications: IHC, WB

Publications for Morg1 Protein (NBP1-92133PEP) (0)

There are no publications for Morg1 Protein (NBP1-92133PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Morg1 Protein (NBP1-92133PEP) (0)

There are no reviews for Morg1 Protein (NBP1-92133PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Morg1 Protein (NBP1-92133PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Morg1 Products

Research Areas for Morg1 Protein (NBP1-92133PEP)

Find related products by research area.

Blogs on Morg1

There are no specific blogs for Morg1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Naive CD4 T cells from WT, VHL-deficient (Vhl KO), or HIF-1 alpha-deficient (HIF-1 alpha KO) mice were differentiated under IL-22-skewing conditions for a total of 60 h. Some cells remained at normoxia for the duration of the culture (N); others were at normoxia for 35 h and then hypoxia (1% O2) for 24 h (H). At 60 h, nuclear extracts were harvested, and HIF-1 alpha and Lamin B1 levels were analyzed by Western blot. Image from verified customer review.
HIF-1 alpha Antibody (H1alpha67)
NB100-105

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Morg1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol WDR83