Home » MLH3 » MLH3 Proteins » MLH3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MLH3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MLH3 Recombinant Protein Antigen (NBP2-55958PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MLH3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MLH3.

Source: E. coli

Amino Acid Sequence: TTGGIQGTLPLTVQKVLASQACHGAIKFNDGLSLQESCRLIEALSSCQLPFQCAHGRPSMLPLADIDHLEQEKQIKPNLTKLRKMA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MLH3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55958.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MLH3 Recombinant Protein Antigen

  • DNA mismatch repair protein Mlh3
  • HNPCC7
  • MGC138372
  • mutL (E. coli) homolog 3
  • mutL homolog 3 (E. coli)
  • MutL protein homolog 3

Background

MLH3 is a member of the MutL-homolog (MLH) family of DNA mismatch repair (MMR) genes. MLH genes are implicated in maintaining genomic integrity during DNA replication and after meiotic recombination. The protein encoded by this gene functions as a heterodimer with other family members. Somatic mutations in this gene frequently occur in tumors exhibiting microsatellite instability, and germline mutations have been linked to hereditary nonpolyposis colorectal cancer type 7 (HNPCC7). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MLH1 Antibody
(SP08-04)
NBP2-67381
Flow Cytometry MLH1 Antibody (SP08-04)
Immunocytochemistry/ Immunofluorescence MLH1 Antibody (SP08-04)
Immunohistochemistry-Paraffin MLH1 Antibody (SP08-04)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
MSH2 Antibody
(MSH2/2622)
NBP3-07211
Flow Cytometry MSH2 Antibody (MSH2/2622)
Immunocytochemistry/ Immunofluorescence MSH2 Antibody (MSH2/2622)
Immunohistochemistry-Paraffin MSH2 Antibody (MSH2/2622)
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MSH6 Antibody
NBP1-83319
Immunocytochemistry/ Immunofluorescence MSH6 Antibody
Immunohistochemistry-Paraffin MSH6 Antibody
Immunohistochemistry-Paraffin MSH6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PMS2 Antibody
(OTI2G5)
NBP2-46459
Immunofluorescence PMS2 Antibody (OTI2G5)
Immunohistochemistry PMS2 Antibody (OTI2G5)
Immunohistochemistry PMS2 Antibody (OTI2G5)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MMR/CD206/Mannose
Receptor Antibody [Un ...
AF2535
Immunohistochemistry MMR/CD206/Mannose Receptor Antibody [Unconjugated]
Western Blot MMR/CD206/Mannose Receptor Antibody [Unconjugated]
Immunohistochemistry MMR/CD206/Mannose Receptor Antibody [Unconjugated]
(2 Reviews)
(193 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
PMS1 Antibody
(PCRP-PMS1-2E11)
NBP3-13739
Flow Cytometry PMS1 Antibody (PCRP-PMS1-2E11)
Immunocytochemistry/ Immunofluorescence PMS1 Antibody (PCRP-PMS1-2E11)
Protein Array PMS1 Antibody (PCRP-PMS1-2E11)
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA
MSH3 Antibody
(CL14059)
NBP3-24587
Immunohistochemistry-Paraffin MSH3 Antibody (CL14059)
Western Blot MSH3 Antibody (CL14059)
Immunohistochemistry-Paraffin MSH3 Antibody (CL14059)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MSH4 Antibody -
BSA Free
NBP2-94754
Western Blot MSH4 Antibody - BSA Free
Species: Mu, Rt
Applications: WB
MSH5 Antibody
NBP1-20946
Immunohistochemistry-Paraffin MSH5 Antibody
Immunohistochemistry-Paraffin MSH5 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Rad51 Antibody
(14B4)
NB100-148
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
(5 Reviews)
(66 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
Exonuclease 1
Antibody
NBP2-16391
Western Blot Exonuclease 1 Antibody
Western Blot Exonuclease 1 Antibody
Immunocytochemistry/ Immunofluorescence Exonuclease 1 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, WB
Blooms Syndrome
Protein Blm Antibody
NBP1-89929
Immunohistochemistry-Paraffin Blooms Syndrome Protein Blm Antibody
Immunocytochemistry/ Immunofluorescence Blooms Syndrome Protein Blm Antibody
(1 Review)
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MBD4 Antibody -
BSA Free
NBP1-91189
Immunocytochemistry/ Immunofluorescence MBD4 Antibody - BSA Free
Immunohistochemistry MBD4 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu(-)
Applications: ICC/IF, IHC, IHC-P, WB (-)
Mus81 Antibody -
BSA Free
NBP2-95212
Immunohistochemistry-Paraffin Mus81 Antibody - BSA Free
Western Blot Mus81 Antibody - BSA Free
Immunohistochemistry-Paraffin Mus81 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CROP Antibody
NBP1-88053
Immunohistochemistry-Paraffin CROP Antibody
Western Blot CROP Antibody
Immunohistochemistry-Paraffin CROP Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
SCP1 Antibody -
BSA Free
NB300-229
Immunocytochemistry/ Immunofluorescence SCP1 Antibody - BSA Free
Western Blot SCP1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SCP1 Antibody - BSA Free
(3 Reviews)
(57 Publications)
Species: Ch, Hu(-), Ma, Pm, Mu, Pa, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
SPO11 Antibody
NBP1-58172
Western Blot SPO11 Antibody
Western Blot SPO11 Antibody
(1 Publication)
Species: Hu, Mu
Applications: WB

Publications for MLH3 Recombinant Protein Antigen (NBP2-55958PEP) (0)

There are no publications for MLH3 Recombinant Protein Antigen (NBP2-55958PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLH3 Recombinant Protein Antigen (NBP2-55958PEP) (0)

There are no reviews for MLH3 Recombinant Protein Antigen (NBP2-55958PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MLH3 Recombinant Protein Antigen (NBP2-55958PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MLH3 Products

Research Areas for MLH3 Recombinant Protein Antigen (NBP2-55958PEP)

Find related products by research area.

Blogs on MLH3

There are no specific blogs for MLH3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

MMR/CD206 was detected in perfusion fixed frozen sections of mouse testis using Goat Anti-Mouse MMR/CD206 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2535) at 5 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to spermatocytes in testis. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
MMR/CD206/Mannose Receptor Antibody [Unconjugated]
AF2535
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Rad51 Antibody (14B4)
NB100-148
Immunocytochemistry/Immunofluorescence: SCP1 Antibody [NB300-229] - Mouse spermatozoa. Green: SCP1 staining. ICC/IF image submitted by a verified customer review.
SCP1 Antibody - BSA Free
NB300-229

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MLH3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MLH3