![Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Analysis in human kidney and endometrium tissues. Corresponding Map17 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Map17-Antibody-Immunohistochemistry-Paraffin-NBP1-84290-img0012.jpg "Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Analysis in human kidney and endometrium tissues. Corresponding Map17 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QEEPEPAHMILTVGNKADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRST |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PDZK1IP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Map17 Antibody (NBP1-84290)Find related products by research area.
|
|
One MAP to Navigate the Oxidative Stress, Tumorigenesis and Apoptosis Pathways? Reactive oxygen species, ROS, are beneficially involved in many signaling pathways that control development and maintain cellular homeostasis. In physiological conditions, a tightly regulated redox balance protects cells from injurious ROS activity, a... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PDZK1IP1 |
![Western Blot: Map17 Antibody [NBP1-84290] - Analysis in control (vector only transfected HEK293T lysate) and PDZK1IP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Map17-Antibody-Western-Blot-NBP1-84290-img0011.jpg "Western Blot: Map17 Antibody [NBP1-84290] - Analysis in control (vector only transfected HEK293T lysate) and PDZK1IP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunocytochemistry/Immunofluorescence: Map17 Antibody [NBP1-84290] - Staining of human cell line RPTEC TERT1 shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Map17-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84290-img0010.jpg "Immunocytochemistry/Immunofluorescence: Map17 Antibody [NBP1-84290] - Staining of human cell line RPTEC TERT1 shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Staining of human skin shows weak membranous and cytoplasmic positivity in superficial layer of squamous epithelial cells.](http://images.novusbio.com/fullsize/Map17-Antibody-Immunohistochemistry-Paraffin-NBP1-84290-img0016.jpg "Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Staining of human skin shows weak membranous and cytoplasmic positivity in superficial layer of squamous epithelial cells.")
![Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Map17-Antibody-Immunohistochemistry-Paraffin-NBP1-84290-img0013.jpg "Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Staining of human kidney shows strong positivity in apical membrane in cells in tubules.](http://images.novusbio.com/fullsize/Map17-Antibody-Immunohistochemistry-Paraffin-NBP1-84290-img0014.jpg "Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Staining of human kidney shows strong positivity in apical membrane in cells in tubules.")
![Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Staining of human lymphoid tissues shows moderate cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/Map17-Antibody-Immunohistochemistry-Paraffin-NBP1-84290-img0015.jpg "Immunohistochemistry-Paraffin: Map17 Antibody [NBP1-84290] - Staining of human lymphoid tissues shows moderate cytoplasmic positivity in non-germinal center cells.")
![Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Western_Blot_10680.jpg)
![Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_Immunohistochemistry_10732.jpg)
![ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]](https://images.novusbio.com/images2/Prostatic_Acid_Phosphatase_AF6240_ELISA_22233.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")