![Western Blot: HOXC9 Antibody [NBP2-87596] - WB Suggested Anti-HOXC9 Antibody Titration: 2.5ug/ml. Positive Control: Transfected 293T](http://images.novusbio.com/fullsize/HOXC9-Antibody-Western-Blot-NBP2-87596-img0002.jpg "Western Blot: HOXC9 Antibody [NBP2-87596] - WB Suggested Anti-HOXC9 Antibody Titration: 2.5ug/ml. Positive Control: Transfected 293T")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HOXC9. Peptide sequence: DRAPQTLPSPEADALAGSKHKEEKADLDPSNPVANWIHARSTRKKRCPYT The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HOXC9 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HOXC9 |
![Immunohistochemistry: HOXC9 Antibody [NBP2-87596] - Human Lung](http://images.novusbio.com/fullsize/HOXC9-Antibody-Immunohistochemistry-NBP2-87596-img0001.jpg "Immunohistochemistry: HOXC9 Antibody [NBP2-87596] - Human Lung")
![Western Blot: HOXC9 Antibody [NBP2-87596] - Host: Rabbit. Target Name: HOXC9. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/HOXC9-Antibody-Western-Blot-NBP2-87596-img0003.jpg "Western Blot: HOXC9 Antibody [NBP2-87596] - Host: Rabbit. Target Name: HOXC9. Sample Tissue: Human Jurkat Whole Cell. Antibody Dilution: 1ug/ml")
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")