HOXB6 Antibody (8E3) Summary
Immunogen |
HOXB6 (NP_724779.1, 1 a.a. ~ 57 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQDKGFATSS |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
HOXB6 |
Purity |
Protein A or G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A or G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for HOXB6 Antibody (8E3)
Background
The HOXB6 gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Rb
Applications: ELISA, Func, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ChIP, ELISA, IP, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Fe, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: ELISA
Species: Hu
Applications: ChIP, ICC/IF, IP, WB
Publications for HOXB6 Antibody (H00003216-M01-100ug) (0)
There are no publications for HOXB6 Antibody (H00003216-M01-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HOXB6 Antibody (H00003216-M01-100ug) (0)
There are no reviews for HOXB6 Antibody (H00003216-M01-100ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HOXB6 Antibody (H00003216-M01-100ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HOXB6 Products
Array H00003216-M01-100ug
Blogs on HOXB6