Home » HIVEP3 » HIVEP3 Proteins » HIVEP3 Recombinant Protein Antigen

HIVEP3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HIVEP3 Protein (NBP1-93993PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

HIVEP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HIVEP3.

Source: E. coli

Amino Acid Sequence: SYSFDDHITDSEALSRSSHVFTSHPRMLKRQPAIELPLGGEYSSEEPGPSSKDTASKPSDEVEPKESELTKKTKKGLKTKGVIYECNICGARYKKRDNYEAHKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMHYKLGTTL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HIVEP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-93993.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HIVEP3 Recombinant Protein Antigen

  • FLJ16752
  • human immunodeficiency virus type I enhancer binding protein 3
  • kappa-binding protein 1
  • KBP1
  • KBP-1
  • KRC
  • Schnurri-3
  • transcription factor HIVEP3
  • ZAS family, member 3
  • ZAS3
  • zinc finger protein ZAS3
  • ZNF40C

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(821 Publications)
Species: Hu
Applications: BA
HIVEP2 Antibody
NBP1-46125
HIVEP2 Antibody
(1 Publication)
Species: Bv, Ca, Hu, Mu, Rt
Applications: PEP-ELISA
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
JunD Antibody
(2D5A1)
NBP3-16602
Immunoprecipitation JunD Antibody (2D5A1)
Western Blot JunD Antibody (2D5A1)
Immunohistochemistry JunD Antibody (2D5A1)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/ Immunofluorescence JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(379 Publications)
Species: Hu
Applications: BA
c-Fos Antibody
(2H2)
NBP2-50037
Western Blot c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(24 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
FosB/G0S3 Antibody
[Unconjugated]
AF2214
Immunocytochemistry FosB/G0S3 Antibody [Unconjugated]
Immunohistochemistry FosB/G0S3 Antibody [Unconjugated]
Species: Hu
Applications: ICC, IHC, WB
TRAF-2 Antibody
NB100-56173
Immunocytochemistry/ Immunofluorescence TRAF-2 Antibody
Immunohistochemistry TRAF-2 Antibody
Immunohistochemistry-Paraffin TRAF-2 Antibody
(4 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
S100A4 Antibody
(1F12-1G7)
H00006275-M01
Western Blot S100A4 Antibody (1F12-1G7)
Western Blot S100A4 Antibody (1F12-1G7)
ELISA S100A4 Antibody (1F12-1G7)
(17 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
WWP1 Antibody (1A7)
H00011059-M01
Western Blot WWP1 Antibody (1A7)
Western Blot WWP1 Antibody (1A7)
Immunocytochemistry/ Immunofluorescence WWP1 Antibody (1A7)
(20 Publications)
Species: Hu, Pm
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
RAG2 Antibody
NBP2-43666
Immunocytochemistry/ Immunofluorescence RAG2 Antibody
Immunohistochemistry-Paraffin RAG2 Antibody
Western Blot RAG2 Antibody
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ZNF645 Antibody
NBP2-21037
Western Blot ZNF645 Antibody
Immunohistochemistry-Paraffin ZNF645 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
RUNX2/CBFA1
Antibody (232902) [Un ...
MAB2006
Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]
Immunohistochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]
(1 Review)
(28 Publications)
Species: Hu
Applications: ICC
IFN-alpha 1
Antibody
NBP2-75930
Western Blot IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MUL1 Antibody
(5H6.2D5) - BSA Free
NBP2-31361
Western Blot MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Species: Hu
Applications: IHC, IHC-P, WB
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin TRIM50 Antibody
Species: Hu
Applications: IHC, IHC-P
LARP6 Antibody
H00055323-B01P
Western Blot LARP6 Antibody
Immunocytochemistry/ Immunofluorescence LARP6 Antibody
(13 Publications)
Species: Hu, Mu
Applications: ICC/IF, IP, WB
TANK Antibody
NB100-56144
Immunohistochemistry TANK Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for HIVEP3 Protein (NBP1-93993PEP) (0)

There are no publications for HIVEP3 Protein (NBP1-93993PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HIVEP3 Protein (NBP1-93993PEP) (0)

There are no reviews for HIVEP3 Protein (NBP1-93993PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HIVEP3 Protein (NBP1-93993PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HIVEP3 Products

Array NBP1-93993PEP

Blogs on HIVEP3

There are no specific blogs for HIVEP3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.
IL-2 [Unconjugated]
202-IL-010
Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
c-Fos Antibody (2H2)
NBP2-50037

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HIVEP3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HIVEP3