HEXIM2 Recombinant Protein Antigen

Name: HEXIM2 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-93877PEP
Price: 279 USD

Images

There are currently no images for HEXIM2 Protein (NBP1-93877PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

HEXIM2 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HEXIM2. Source: E. coli Amino Acid Sequence: YNTTQFLMNDRDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERFHTESLQGRSKQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	HEXIM2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-93877. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HEXIM2 Recombinant Protein Antigen

FLJ32384
hexamethylene bis-acetamide inducible 2
hexamethylene bis-acetamide-inducible protein 2
hexamethylene-bis-acetamide-inducible transcript 2
hexamthylene bis-acetamide inducible 2
L3
MAQ1 paralog
protein HEXIM2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RPL4 Antibody (4A3)

H00006124-M01

Immunocytochemistry/ Immunofluorescence RPL4 Antibody (4A3)

(2 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, S-ELISA, WB

FAM60A Antibody

H00058516-B02P

Immunocytochemistry/ Immunofluorescence FAM60A Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, KD, WB

PPFIBP1 Antibody

NBP1-83192

Immunocytochemistry/ Immunofluorescence PPFIBP1 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

ZACN Antibody

NBP1-80104

Species: Hu

Applications: WB

FAM49B Antibody

NBP1-88582

Immunohistochemistry-Paraffin FAM49B Antibody

Immunocytochemistry/ Immunofluorescence FAM49B Antibody

(2 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

RPL5 Antibody

NBP1-31413

Immunohistochemistry-Paraffin RPL5 Antibody

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, WB

TM4SF1/L6 Antibody
(877621) [Unconjugate ...

MAB8164

Flow Cytometry TM4SF1/L6 Antibody (877621) [Unconjugated]

(2 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, ICC, IHC

RPL6 Antibody

NBP2-20216

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

MED10 Antibody

NBP1-81328

Immunocytochemistry/ Immunofluorescence MED10 Antibody

Species: Hu

Applications: ICC/IF, WB

Rpn2 Antibody

NBP2-38323

Immunohistochemistry-Paraffin Rpn2 Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

CD6 Antibody

AF750

(14 Publications)

Species: Mu

Applications: AdBlk, WB

Dystrophin Antibody

NBP1-89953

(4 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

Bestrophin 1
Antibody (E6-6) - BSA

NB300-164

Immunohistochemistry-Paraffin Bestrophin 1 Antibody (E6-6) - BSA Free

(1 Review)

(49 Publications)

Species: Ca, Hu, Mu, Po, Pm, Rt(-)

Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, PLA, WB

Catalase Antibody
[Unconjugated]

AF3398

Simple Western Catalase Antibody [Unconjugated]

Knockout Validated Catalase Antibody [Unconjugated]

(3 Reviews)

(15 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, Simple Western, WB

RPL3 Antibody

NBP2-20214

Immunohistochemistry-Paraffin RPL3 Antibody

Immunocytochemistry/ Immunofluorescence RPL3 Antibody

(1 Publication)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

CD2 Antibody
(RPA-2.10)

NBP2-25200

(1 Review)

Species: Hu

Applications: B/N, Flow, IHC, IHC-Fr, WB

CRAT Antibody

NBP1-86616

Immunohistochemistry-Paraffin CRAT Antibody

(2 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

GLYAT Antibody

NBP2-58917

Immunohistochemistry-Paraffin GLYAT Antibody

Species: Hu

Applications: IHC, IHC-P, WB

CD38 Antibody
(1G7F4) - Azide Free

NBP2-25265

Western Blot CD38 Antibody (1G7F4) - Azide Free

Simple Western CD38 Antibody (1G7F4) - Azide Free

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

HEXIM2 Recombinant
Protein Antigen

NBP1-93877PEP

Species: Hu

Applications: AC

Publications for HEXIM2 Protein (NBP1-93877PEP) (0)

There are no publications for HEXIM2 Protein (NBP1-93877PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEXIM2 Protein (NBP1-93877PEP) (0)

There are no reviews for HEXIM2 Protein (NBP1-93877PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HEXIM2 Protein (NBP1-93877PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HEXIM2 Products

Blogs on HEXIM2

There are no specific blogs for HEXIM2, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Bestrophin 1 Antibody (E6-6) - BSA Free
NB300-164

Western blot shows lysates of Jurkat human acute T cell leukemia cell line, Raji human Burkitt's lymphoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH-3T3 mouse embryonic fibroblast cell line, A20 mouse B cell lymphoma cell line, and Rat-2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human/Mouse/Rat Catalase Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3398) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for Catalase at approximately 64 kDa (as indicated). This experiment was conducted using Immunoblot Buffer Group 2.

Catalase Antibody [Unconjugated]
AF3398

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our HEXIM2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

HEXIM2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

HEXIM2 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

HEXIM2 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for HEXIM2 Recombinant Protein Antigen

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for HEXIM2 Protein (NBP1-93877PEP) (0)

Reviews for HEXIM2 Protein (NBP1-93877PEP) (0)

FAQs for HEXIM2 Protein (NBP1-93877PEP) (0)

Additional HEXIM2 Products

Blogs on HEXIM2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics