GSTM3 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GSTM3. Source: E. coli
Amino Acid Sequence: TYDILDQNRIFDPKCLDEFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINN Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
GSTM3 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83323. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for GSTM3 Recombinant Protein Antigen
Background
GSTM3, also known as Glutathione S-transferase Mu 3, is a 225 amino acid that is approx. 27 kDa; is responsible for conjugation of reduced glutathione to an extensive number of exogenous and endogenous hydrophobic electrophiles, and may be able to regulate uptake and detoxification of both endogenous compounds and xenobiotics at the testis and brain blood barriers. Current research is being performed on over 70 diseases and disorders including laryngeal squamous cell carcinoma, pharyngitis, laryngitis, squamous cell carcinoma, laryngeal cancer, oral cancer, cataract, colorectal cancer, carcinoma, breast cancer, astrocytoma, non-Hodgkin lymphoma, malignant pleural mesothelioma, open-angle glaucoma, Hodgkin's lymphoma, lung cancer, basal cell carcinoma, adult brain tumor, and leukoplakia. This protein has been shown to have interactions with over 70 proteins including RBL2, GSTM2, PAK2, MPG, and TFE3 in pathways such as glutathione metabolism, metabolism of xenobiotics by cytochrome P450, drug metabolism - cytochrome P450, establishment of blood-nerve barrier, and response to estrogen stimulus pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt, V-Vi
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
Species: Hu
Applications: BA
Publications for GSTM3 Protein (NBP1-83323PEP) (0)
There are no publications for GSTM3 Protein (NBP1-83323PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GSTM3 Protein (NBP1-83323PEP) (0)
There are no reviews for GSTM3 Protein (NBP1-83323PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for GSTM3 Protein (NBP1-83323PEP) (0)
Additional GSTM3 Products
Research Areas for GSTM3 Protein (NBP1-83323PEP)
Find related products by research area.
|
Blogs on GSTM3