![Western Blot: Gonadotropin Inducible Transcription Repressor 1 Antibody [H00092283-B01P] - Analysis of GIOT-1 expression in human liver.](http://images.novusbio.com/fullsize/Gonadotropin-Inducible-Transcription-Repressor-1-Antibody-Western-Blot-H00092283-B01P-img0006.jpg "Western Blot: Gonadotropin Inducible Transcription Repressor 1 Antibody [H00092283-B01P] - Analysis of GIOT-1 expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ZNF461 (NP_694989.2, 1 a.a. - 563 a.a.) full-length human protein. MAHELVMFRDVAIDVSQEEWECLNPAQRNLYKEVMLENYSNLVSLGLSVSKPAVISSLEQGKEPWMVVREETGRWCPGTWKTWGFHNNFLDNNEATDINADLASRDEPQKLSPKRDIYETELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKELSECKECTEIVNTPCLFKQQTIQNGDKCNECKECWKAFVHCSQLKHLRIHNGEKRYECNECGKAFNYGSELTLHQRIHTGEKPYECKECGKAFRQRSQLTQHQRLHTGEKPYECKQCGKAFIRGFQLTEHLRLHTGEKPYECKECGKTFRHRSHLTIHQRIHTGEKPYECRECGKAFSYHSSFSHHQKIHSGKKPYECHECGKAFCDGLQLTLHQRIHTGEKPYECKECGKTFRQCSHLKRHQRIHTGEKPHECMICGKAFRLHSHLIQHQRIHTGEKPYECKECGKAFSYHSSFSHHQRIHSGKKPYQCGKAFNHRLQLNLHQTLHTGEKPVRFPLLPPHPSLAS |
| Specificity | ZNF461 - zinc finger protein 461, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | ZNF461 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot and also on transfected lysate in Western Blot. GST tag alone is used as a negative control. Has also been used for immunofluorescence. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ZNF461 |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: Gonadotropin Inducible Transcription Repressor 1 Antibody [H00092283-B01P] - Analysis of purified antibody to ZNF461 on HepG2 cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/Gonadotropin-Inducible-Transcription-Repressor-1-Antibody-Immunocytochemistry-Immunofluorescence-H00092283-B01P-img0004.jpg "Immunocytochemistry/Immunofluorescence: Gonadotropin Inducible Transcription Repressor 1 Antibody [H00092283-B01P] - Analysis of purified antibody to ZNF461 on HepG2 cell. (antibody concentration 10 ug/ml)")
![Western Blot: Gonadotropin Inducible Transcription Repressor 1 Antibody [H00092283-B01P] - Analysis of ZNF461 expression in Jurkat.](http://images.novusbio.com/fullsize/Gonadotropin-Inducible-Transcription-Repressor-1-Antibody-Western-Blot-H00092283-B01P-img0005.jpg "Western Blot: Gonadotropin Inducible Transcription Repressor 1 Antibody [H00092283-B01P] - Analysis of ZNF461 expression in Jurkat.")
![Western Blot: Gonadotropin Inducible Transcription Repressor 1 Antibody [H00092283-B01P] - Analysis of ZNF461 expression in transfected 293T cell line by ZNF461 polyclonal antibody. Lane 1: GIOT-1 transfected lysate(61.93 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Gonadotropin-Inducible-Transcription-Repressor-1-Antibody-Western-Blot-H00092283-B01P-img0007.jpg "Western Blot: Gonadotropin Inducible Transcription Repressor 1 Antibody [H00092283-B01P] - Analysis of ZNF461 expression in transfected 293T cell line by ZNF461 polyclonal antibody. Lane 1: GIOT-1 transfected lysate(61.93 KDa). Lane 2: Non-transfected lysate.")
![Immunohistochemistry Galectin-4 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2128_mouse-galectin-4-affinity-purified-polyclonal-ab-immunohistochemistry-29122022154254.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")