ERK1 Inhibitor Peptide Set

Functions as a MEK decoy by binding to ERK.

The ERK inhibitory peptide also contains a protein transduction (PTD) sequence (DRQIKIWFQNRRMKWKK) derived from antennapedia which renders the peptide cell permeable.

The control peptide consists of only the PTD sequence.

Preparation of 5 mM Stock Solutions
PBS* is added directly to the vials to prepare the stock solutions. Note: Bring the solution to room temperature and quick spin the tubes before opening the caps.

ERK Inhibitor Peptide: 1 mg of DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN
Add 53 ul of PBS* to the vial to make a 5 mM stock solution. Mix by vortexing. Aliquot and store at -20C or -80C. Avoid repeated freeze thawing.

Control Peptide: 1 mg of DRQIKIWFQNRRMKWKK
Add 84.8 ul PBS* to the vial. Mix by vortexing. Aliquot and store at 20C or -80C. Avoid repeated freeze thawing.
Recipe for 1X PBS:
1. Dissolve the following in 800ml distilled H2O.
-8g of NaCl
-0.2g of KCl
-1.44g of Na2HPO4
-0.24g of KH2PO4
2. Adjust pH to 7.5 with HCl.
3. Adjust volume to 1L with additional distilled H2O.
4. Sterilize by autoclaving.

ERK Inhibitor peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1 mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361

MAPK3

Inhibition of Erk activation.
The inhibitor peptide is to block ERK activation by MEK. Optimal peptide concentrations and incubation times vary between model systems and should be determined empirically by users. A 100 uM final concentration may be a useful starting point.

Please refer to Kalemen et al (2002) for additional information about how the inhibitor peptide has been used to block ERK activation by MEK.