Home » DNAJC6 » DNAJC6 Proteins » DNAJC6 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

DNAJC6 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for DNAJC6 Protein (NBP1-81507PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

DNAJC6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DNAJC6.

Source: E. coli

Amino Acid Sequence: NGDKPHGVKKPSKKQQEPAAPPPPEDVDLLGLEGSAMSNSFSPPAAPPTNSELLSDLFGGGGAAGPTQAGQSGVEDVFHPSGPASTQSTP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DNAJC6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81507.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DNAJC6 Recombinant Protein Antigen

  • DJC6
  • DnaJ (Hsp40) homolog, subfamily B, member 6
  • DnaJ (Hsp40) homolog, subfamily C, member 6
  • DnaJ homolog subfamily C member 6
  • EC 3.1.3.48
  • KIAA0473auxilin
  • MGC129914
  • MGC129915
  • MGC48436
  • putative tyrosine-protein phosphatase auxilin

Background

DNAJC6 belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus, a glycine/phenylalanine (G/F)-rich region, and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain (Ohtsuka and Hata, 2000 [PubMed 11147971]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HSPA8/HSC71/Hsc70
Antibody (13D3)
NB120-2788
Immunocytochemistry/ Immunofluorescence HSPA8/HSC71/Hsc70 Antibody (13D3)
Immunocytochemistry/ Immunofluorescence HSPA8/HSC71/Hsc70 Antibody (13D3)
Immunocytochemistry/ Immunofluorescence HSPA8/HSC71/Hsc70 Antibody (13D3)
(2 Reviews)
(28 Publications)
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
PTEN Antibody
[Unconjugated]
AF847
Western Blot PTEN Antibody [Unconjugated]
Simple Western PTEN Antibody [Unconjugated]
Knockout Validated PTEN Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
DNAJA2 Antibody
(OTI3A10)
NBP2-02996
Flow Cytometry DNAJA2 Antibody (OTI3A10)
Western Blot DNAJA2 Antibody (OTI3A10)
Immunohistochemistry-Paraffin DNAJA2 Antibody (OTI3A10)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
GAK Antibody
(706306)
MAB6918
Western Blot GAK Antibody (706306)
(2 Publications)
Species: Hu
Applications: WB
HspA4 Antibody
NBP1-81696
Western Blot HspA4 Antibody
Immunohistochemistry-Paraffin HspA4 Antibody
Western Blot HspA4 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AP2 alpha Antibody
(3B5)
NB100-74359
Western Blot AP2 alpha Antibody (3B5)
Immunohistochemistry-Frozen AP2 alpha Antibody (3B5)
Western Blot AP2 alpha Antibody (3B5)
(1 Review)
(3 Publications)
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DNAJB6 Antibody
(2C11-C1)
H00010049-M01
ELISA DNAJB6 Antibody (2C11-C1)
Western Blot DNAJB6 Antibody (2C11-C1)
Western Blot DNAJB6 Antibody (2C11-C1)
(9 Publications)
Species: Hu
Applications: ELISA, ICC/IF (-), IHC, WB
AP180 Antibody
(HL1657) - Azide and ...
NBP3-25690
Western Blot AP180 Antibody (HL1657) - Azide and BSA Free
Western Blot AP180 Antibody (HL1657) - Azide and BSA Free
Immunohistochemistry-Paraffin AP180 Antibody (HL1657) - Azide and BSA Free
Species: Fe, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
HSP40/DNAJB1
Antibody (OTI1F9)
NBP2-03433
Flow Cytometry HSP40/DNAJB1 Antibody (OTI1F9)
Immunocytochemistry/ Immunofluorescence HSP40/DNAJB1 Antibody (OTI1F9)
Immunohistochemistry-Paraffin HSP40/DNAJB1 Antibody (OTI1F9)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Cyclin G Antibody
- BSA Free
NBP2-92649
Immunohistochemistry-Paraffin Cyclin G Antibody - BSA Free
Immunohistochemistry-Paraffin Cyclin G Antibody - BSA Free
Western Blot Cyclin G Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
JunD Antibody
(512709)
MAB5526
Western Blot JunD Antibody (512709)
(2 Publications)
Species: Hu, Mu
Applications: WB
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/ Immunofluorescence JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
FABP4/A-FABP
Antibody [Unconjugate
AF1443
Immunocytochemistry FABP4/A-FABP Antibody [Unconjugated]
Western Blot FABP4/A-FABP Antibody [Unconjugated]
Immunohistochemistry FABP4/A-FABP Antibody [Unconjugated]
(2 Reviews)
(40 Publications)
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
HSCB Antibody
(OTI3E1)
NBP2-46506
Western Blot HSCB Antibody (OTI3E1)
Western Blot HSCB Antibody (OTI3E1)
Immunohistochemistry-Paraffin HSCB Antibody (OTI3E1)
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
GTF3A Antibody
NBP2-04017
Western Blot GTF3A Antibody
Species: Hu
Applications: IP, WB

Publications for DNAJC6 Protein (NBP1-81507PEP) (0)

There are no publications for DNAJC6 Protein (NBP1-81507PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DNAJC6 Protein (NBP1-81507PEP) (0)

There are no reviews for DNAJC6 Protein (NBP1-81507PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DNAJC6 Protein (NBP1-81507PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DNAJC6 Products

Blogs on DNAJC6

There are no specific blogs for DNAJC6, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

FABP4 was detected in immersion fixed mouse mesenchymal stem cell-derived adipocytes using 10 µg/mL Goat Anti-Mouse/Rat FABP4 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1443) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
FABP4/A-FABP Antibody [Unconjugated]
AF1443
Immunocytochemistry/Immunofluorescence: Hsp70 / Hsc70 Antibody (13D3) [NB120-2788] - Formalin fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 10 minutes at room temperature and blocked with 1% Blocker BSA for 15 minutes at room temperature. Cells were probed with a HSP70 monoclonal antibody at a dilution of 1:50 for at least 1 hour at room temperature, washed with PBS, and incubated with DyLight 488 goat anti-mouse IgG secondary antibody at a dilution of 1:400 for 30 minutes at room temperature. Nuclei (blue) were stained with Hoechst 33342 dye.
HSPA8/HSC71/Hsc70 Antibody (13D3)
NB120-2788

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DNAJC6 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DNAJC6