![Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Analysis in human fallopian tube and liver tissues. Corresponding DNAH5 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/DNAH5-Antibody-Immunohistochemistry-Paraffin-NBP1-84463-img0013.jpg "Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Analysis in human fallopian tube and liver tissues. Corresponding DNAH5 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EVEDAILEGNQIERIDQLFAVGGLRHLMFYYQDVEEAETGQLGSLGGVNLVSGKIKKPKVFVTEGNDVALTGVCVFFIRTDPSKAITPD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DNAH5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. IP reported in scientific literature (PMID: 25232951). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DNAH5 |
![Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human cerebral cortex, fallopian tube, liver and nasopharynx using Anti-DNAH5 antibody NBP1-84463 (A) shows similar protein distribution across tissues to independent antibody NBP1-84464 (B).](http://images.novusbio.com/fullsize/DNAH5-Antibody-Immunohistochemistry-Paraffin-NBP1-84463-img0016.jpg "Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human cerebral cortex, fallopian tube, liver and nasopharynx using Anti-DNAH5 antibody NBP1-84463 (A) shows similar protein distribution across tissues to independent antibody NBP1-84464 (B).")
![Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human lymph node shows no positivity as expected.](http://images.novusbio.com/fullsize/DNAH5-Antibody-Immunohistochemistry-Paraffin-NBP1-84463-img0019.jpg "Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human lymph node shows no positivity as expected.")
![Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human nasopharynx.](http://images.novusbio.com/fullsize/DNAH5-Antibody-Immunohistochemistry-Paraffin-NBP1-84463-img0012.jpg "Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human nasopharynx.")
![Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/DNAH5-Antibody-Immunohistochemistry-Paraffin-NBP1-84463-img0014.jpg "Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.](http://images.novusbio.com/fullsize/DNAH5-Antibody-Immunohistochemistry-Paraffin-NBP1-84463-img0017.jpg "Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.")
![Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/DNAH5-Antibody-Immunohistochemistry-Paraffin-NBP1-84463-img0018.jpg "Immunohistochemistry-Paraffin: DNAH5 Antibody [NBP1-84463] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0004.jpg)
![Western Blot AIF Antibody [Unconjugated]](https://images.novusbio.com/images2/AIF_AF1457_Western_Blot_5113.jpg)
![Simple Western AIF Antibody [Unconjugated]](https://images.novusbio.com/images2/16334.jpg)
![Knockout Validated AIF Antibody [Unconjugated]](https://images.novusbio.com/images2/AIF_AF1457_Knockout_Validated_22786.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")