![Western Blot: CEP57 Antibody [H00009702-B01P] - Analysis of CEP57 expression in transfected 293T cell line by CEP57 polyclonal antibody. Lane 1: CEP57 transfected lysate(55 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/CEP57-Antibody-Western-Blot-H00009702-B01P-img0004.jpg "Western Blot: CEP57 Antibody [H00009702-B01P] - Analysis of CEP57 expression in transfected 293T cell line by CEP57 polyclonal antibody. Lane 1: CEP57 transfected lysate(55 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | CEP57 (NP_055494.2, 1 a.a. - 500 a.a.) full-length human protein. MAAASVSAASGSHLSNSFAEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQELTSQLLAAENKCNLLEKQLEYMRNMIKHAEMERTSVLEKQVSLERERQHDQTHVQSQLEKLDLLEQEYNKLTTMQALAEKKMQELEAKLHEEEQERKRMQAKAAELQTGLETNRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY |
| Specificity | CEP57 - centrosomal protein 57kDa, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | CEP57 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CEP57 |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: CEP57 Antibody [H00009702-B01P] - Analysis of purified antibody to CEP57 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/CEP57-Antibody-Immunocytochemistry-Immunofluorescence-H00009702-B01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: CEP57 Antibody [H00009702-B01P] - Analysis of purified antibody to CEP57 on HeLa cell. (antibody concentration 10 ug/ml)")
![FGF basic/FGF2/bFGF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FGF basic/FGF2/bFGF [Unconjugated]")
![Immunohistochemistry FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Immunohistochemistry_17183.jpg)
![Simple Western FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Simple_Western_17471.jpg)
![Western Blot FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Western_Blot_18640.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")