Home » CD155/PVR » CD155/PVR Proteins » CD155/PVR Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CD155/PVR Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CD155/PVR Protein (NBP1-88131PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

CD155/PVR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PVR.

Source: E. coli

Amino Acid Sequence: DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PVR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88131.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD155/PVR Recombinant Protein Antigen

  • CD155 antigen
  • CD155
  • HVED
  • NECL5
  • Necl-5
  • nectin-like 5
  • Nectin-like protein 5
  • poliovirus receptor
  • PVR
  • PVS
  • PVSFLJ25946
  • Tage4

Background

Polio Virus Receptor (PVR) is a member of Ig-superfamily with 3 Ig-domains in arrangement V-C-C. Four mRNAs are produced from single gene for PVR, (mapped to human chromosome band 19q13.1-13.2). Two of the mRNAs (called H20A and H20B or alpha and delta) encode cell surface molecules of about 43kDa and 45kDa polypeptide backbone, respectively. Two other splice variants, beta and gamma encode secreted molecules of about 44kDa. The cytoplasmic tails are short (aa 35-50) and are rich in serine phosphorylated residues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB
PAG3 Antibody
NBP2-24614
Western Blot PAG3 Antibody
Species: Hu, Mu, Ma-Op, Pm, Rt
Applications: WB
Reg3A Antibody
NBP2-24763
Western Blot Reg3A Antibody
Immunohistochemistry-Paraffin Reg3A Antibody
(3 Publications)
Species: Hu, Pm
Applications: IHC, IHC-P, WB
PAPOLA Antibody
NBP1-87345
Immunohistochemistry-Paraffin PAPOLA Antibody
Immunocytochemistry/ Immunofluorescence PAPOLA Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MRPS30 Antibody
NBP1-87343
Immunohistochemistry-Paraffin MRPS30 Antibody
Immunohistochemistry-Paraffin MRPS30 Antibody
Immunohistochemistry-Paraffin MRPS30 Antibody
Species: Hu, Rt
Applications: IHC, IHC-P, WB
ASAP1 Antibody
NBP2-48909
Immunohistochemistry-Paraffin ASAP1 Antibody
Knockout Validated ASAP1 Antibody
Immunocytochemistry/ Immunofluorescence ASAP1 Antibody
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO
TUSC2 Antibody -
BSA Free
NBP3-04411
Immunohistochemistry-Paraffin TUSC2 Antibody - BSA Free
Immunohistochemistry-Paraffin TUSC2 Antibody - BSA Free
Immunohistochemistry-Paraffin TUSC2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PDAP1 Antibody
NBP3-20223
Western Blot PDAP1 Antibody
Immunoprecipitation PDAP1 Antibody
Immunocytochemistry/ Immunofluorescence PDAP1 Antibody
Species: Hu
Applications: ICC/IF, IP, WB
DNAM-1/CD226
Antibody (102511) [Un ...
MAB666
Flow Cytometry DNAM-1/CD226 Antibody (102511) [Unconjugated]
Neutralization DNAM-1/CD226 Antibody (102511) [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin NDUFB6 Antibody
Western Blot NDUFB6 Antibody
Immunocytochemistry/ Immunofluorescence NDUFB6 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Nectin-2/CD112
Antibody [Unconjugate
AF2229
Immunocytochemistry Nectin-2/CD112 Antibody [Unconjugated]
Immunohistochemistry Nectin-2/CD112 Antibody [Unconjugated]
Simple Western Nectin-2/CD112 Antibody [Unconjugated]
(10 Publications)
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
RPE Antibody
NBP1-56853
Western Blot RPE Antibody
Immunohistochemistry-Paraffin RPE Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Pallidin Antibody
(OTI1H9)
NBP2-01763
Western Blot Pallidin Antibody (OTI1H9)
Flow Cytometry Pallidin Antibody (OTI1H9)
Immunohistochemistry-Paraffin Pallidin Antibody (OTI1H9)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
PRH1 His Protein
NBP2-23368
SDS-PAGE Recombinant Human PRH1 His Protein
Species: Hu
Applications: PAGE
EPB42 Antibody
(2G12)
H00002038-M01
Western Blot EPB42 Antibody (2G12)
ELISA EPB42 Antibody (2G12)
Immunocytochemistry/ Immunofluorescence EPB42 Antibody (2G12)
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for CD155/PVR Protein (NBP1-88131PEP) (0)

There are no publications for CD155/PVR Protein (NBP1-88131PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD155/PVR Protein (NBP1-88131PEP) (0)

There are no reviews for CD155/PVR Protein (NBP1-88131PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD155/PVR Protein (NBP1-88131PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD155/PVR Products

Research Areas for CD155/PVR Protein (NBP1-88131PEP)

Find related products by research area.

Blogs on CD155/PVR

There are no specific blogs for CD155/PVR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD155/PVR Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PVR