![Western Blot: AF10 Antibody (6H7) [H00008028-M03] - Analysis of MLLT10 expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/fullsize/AF10-Antibody-6H7-Western-Blot-H00008028-M03-img0003.jpg "Western Blot: AF10 Antibody (6H7) [H00008028-M03] - Analysis of MLLT10 expression in PC-12 (Cat # L012V1).")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 6H7 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | MLLT10 (NP_001009569, 695 a.a. ~ 793 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QIRYDQPGNSSLENLPPVAASIEQLLERQWSEGQQFLLEQGTPSDILGMLKSLHQLQVENRRLEEQIKNLTAKKERLQLLNAQLSVPFPTITANPSPSH |
| Specificity | MLLT10 (6H7) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MLLT10 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate for WB. It has been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: AF10 Antibody (6H7) [H00008028-M03] - Analysis of MLLT10 expression in Hela S3 NE (Cat # L013V3).](http://images.novusbio.com/fullsize/AF10-Antibody-6H7-Western-Blot-H00008028-M03-img0004.jpg "Western Blot: AF10 Antibody (6H7) [H00008028-M03] - Analysis of MLLT10 expression in Hela S3 NE (Cat # L013V3).")
![Western Blot Afadin/AF-6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Afadin_AF7829_Western_Blot_12834.jpg)
![Immunohistochemistry Afadin/AF-6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Afadin_AF7829_Immunohistochemistry_12854.jpg)
![Immunocytochemistry Afadin/AF-6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Afadin_AF7829_Immunocytochemistry_14433.jpg)
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")