![Western Blot: ABH1 Antibody [H00008846-B01P] - Analysis of ALKBH1 expression in transfected 293T cell line by ALKBH1 polyclonal antibody. Lane 1: ALKBH transfected lysate(42.79 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ABH1-Antibody-Western-Blot-H00008846-B01P-img0003.jpg "Western Blot: ABH1 Antibody [H00008846-B01P] - Analysis of ALKBH1 expression in transfected 293T cell line by ALKBH1 polyclonal antibody. Lane 1: ALKBH transfected lysate(42.79 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | ALKBH1 (AAH25787.1, 1 a.a. - 389 a.a.) full-length human protein. MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | ALKBH1 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful for WB, Functional, IF and IHC-P. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
| Publication using H00008846-B01P | Applications | Species |
|---|---|---|
| Trixl L, Amort T, Wille A et al. RNA cytosine methyltransferase Nsun3 regulates embryonic stem cell differentiation by promoting mitochondrial activity. Cell Mol Life Sci 2017-11-04 [PMID: 29103146] |
Secondary Antibodies |
Isotype Controls |
Research Areas for ABH1 Antibody (H00008846-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ALKBH1 |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: ABH1 Antibody [H00008846-B01P] - Analysis of purified antibody to ALKBH on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/ABH1-Antibody-Immunocytochemistry-Immunofluorescence-H00008846-B01P-img0001.jpg "Immunocytochemistry/Immunofluorescence: ABH1 Antibody [H00008846-B01P] - Analysis of purified antibody to ALKBH on HeLa cell. (antibody concentration 10 ug/ml)")
![Immunohistochemistry-Paraffin: ABH1 Antibody [H00008846-B01P] - Analysis of purified antibody to ALKBH1 on formalin-fixed paraffin-embedded human skeletal muscle. (antibody concentration 3 ug/ml)](http://images.novusbio.com/fullsize/ABH1-Antibody-Immunohistochemistry-Paraffin-H00008846-B01P-img0002.jpg "Immunohistochemistry-Paraffin: ABH1 Antibody [H00008846-B01P] - Analysis of purified antibody to ALKBH1 on formalin-fixed paraffin-embedded human skeletal muscle. (antibody concentration 3 ug/ml)")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")