Home » ABCE1 » ABCE1 Proteins » ABCE1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ABCE1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ABCE1 Recombinant Protein Antigen (NBP2-58061PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ABCE1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to ABCE1.

Source: E. coli

Amino Acid Sequence: KAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAAITIRSLINP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCE1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58061.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ABCE1 Recombinant Protein Antigen

  • 2'-5'-oligoadenylate-binding protein
  • ATP-binding cassette, sub-family E (OABP), member 1
  • huHP68
  • OABP
  • Ribonuclease 4 inhibitor
  • ribonuclease L (2'-5'-oligoisoadenylate synthetase-dependent) inhibitor
  • RLIABC38
  • RNase L inhibitor
  • RNASEL1
  • RNASELIRNS4IATP-binding cassette sub-family E member 1

Background

ATP-binding cassette sub-family E member 1 (ABCE1) is a member of the ATP-binding cassette sub-family E, but is not a membrane transporter.

ABCE-1 interacts with RNASEL to inhibit its endoribonuclease activity, and antagonizes the anti-viral effect of the interferon-regulated 2-5A/RNase L pathway. ABCE1 is activated by encephalomyocarditis virus (EMCV) and HIV-1, and recently it has been found to be essential for the assembly of immature immunodeficiency virus capsids.

ABCE1 antibodies are useful tools for HIV studies and research on the ATP-binding cassette families.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

RNase L Antibody
(2E9) - BSA Free
NB100-351
Immunohistochemistry RNase L Antibody (2E9) - BSA Free
Knockout Validated RNase L Antibody (2E9) - BSA Free
Western Blot RNase L Antibody (2E9) - BSA Free
(14 Publications)
Species: Ha, Hu, Mu(-), Pm, Rt(-)
Applications: ELISA, IHC, IHC-P, KO, WB
ABCB6 Antibody
NBP3-41339
Western Blot ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Immunohistochemistry-Paraffin ABCB6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
MRP1 Antibody
(IU2H10) - BSA Free
NB400-156
Dual RNAscope ISH-IHC MRP1 Antibody (IU2H10) - BSA Free
Western Blot MRP1 Antibody (IU2H10) - BSA Free
Immunocytochemistry/ Immunofluorescence MRP1 Antibody (IU2H10) - BSA Free
(17 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
eRF1 Antibody
NBP1-31113
Immunohistochemistry-Paraffin eRF1 Antibody
Immunohistochemistry-Paraffin eRF1 Antibody
Immunocytochemistry/ Immunofluorescence eRF1 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IL-15
[Unconjugated]
247-ILB
SEC-MALS IL-15 [Unconjugated]
(165 Publications)
Species: Hu
Applications: BA
ZFP36L1 Antibody
NBP2-86906
Immunohistochemistry-Paraffin ZFP36L1 Antibody
Immunohistochemistry-Paraffin ZFP36L1 Antibody
Immunohistochemistry-Paraffin ZFP36L1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
AP-2 gamma
Antibody [Unconjugate
AF5059
Western Blot AP-2 gamma Antibody [Unconjugated]
Immunohistochemistry AP-2 gamma Antibody [Unconjugated]
(11 Publications)
Species: Hu
Applications: IHC, WB
ABCB5 Antibody -
BSA Free
NBP1-77687
Immunohistochemistry ABCB5 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence ABCB5 Antibody - BSA Free
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
TRAIL/TNFSF10
[Unconjugated]
375-TL
TRAIL/TNFSF10 [Unconjugated]
(1 Review)
(54 Publications)
Species: Hu
Applications: BA
MRP3 Antibody
NBP2-37923
Immunocytochemistry/ Immunofluorescence MRP3 Antibody
Immunohistochemistry-Paraffin MRP3 Antibody
Immunohistochemistry-Paraffin MRP3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MRP4/ABCC4 Antibody
NB100-1471
Immunohistochemistry-Paraffin MRP4/ABCC4 Antibody
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
ABCF1 Antibody
NBP1-89314
Immunocytochemistry/ Immunofluorescence ABCF1 Antibody
Western Blot ABCF1 Antibody
Immunohistochemistry-Paraffin ABCF1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
FoxC2 Antibody
AF6989
Immunohistochemistry FoxC2 Antibody
Immunohistochemistry FoxC2 Antibody
Immunohistochemistry FoxC2 Antibody
(27 Publications)
Species: Mu
Applications: IHC

Butyrylcholinesterase/ ...
AF9024
Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]
Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]
(2 Publications)
Species: Mu, Rt
Applications: IHC, WB
Elastase Antibody
(CELA3B/1257) - Azide ...
NBP2-54301
Immunohistochemistry-Paraffin Elastase Antibody (CELA3B/1257) - Azide and BSA Free
Immunohistochemistry-Paraffin Elastase Antibody (CELA3B/1257) - Azide and BSA Free
Immunohistochemistry-Paraffin Elastase Antibody (CELA3B/1257) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC, IHC-P, WB
FMN1 Antibody (4F4)
H00342184-M07
ELISA FMN1 Antibody (4F4)
Immunocytochemistry/ Immunofluorescence FMN1 Antibody (4F4)
Western Blot FMN1 Antibody (4F4)
Species: Hu
Applications: ELISA, ICC/IF, WB
MDR1/ABCB1
Antibody (SN06-42)
NBP2-67667
Immunohistochemistry-Paraffin MDR1/ABCB1 Antibody (SN06-42)
Immunohistochemistry-Frozen MDR1/ABCB1 Antibody (SN06-42)
Immunohistochemistry-Paraffin MDR1/ABCB1 Antibody (SN06-42)
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(453 Publications)
Species: Hu
Applications: BA
ABCF2 Antibody
NB400-115
Knockdown Validated ABCF2 Antibody
Immunocytochemistry/ Immunofluorescence ABCF2 Antibody
Simple Western ABCF2 Antibody
Species: Hu, Mu, Ye
Applications: ICC/IF, KD, Simple Western, WB
PMP70 Antibody
NBP1-87258
Immunohistochemistry-Paraffin PMP70 Antibody
Immunohistochemistry-Paraffin PMP70 Antibody
Immunohistochemistry-Paraffin PMP70 Antibody
(5 Publications)
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ABCE1 Recombinant Protein Antigen (NBP2-58061PEP) (0)

There are no publications for ABCE1 Recombinant Protein Antigen (NBP2-58061PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABCE1 Recombinant Protein Antigen (NBP2-58061PEP) (0)

There are no reviews for ABCE1 Recombinant Protein Antigen (NBP2-58061PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ABCE1 Recombinant Protein Antigen (NBP2-58061PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ABCE1 Products

Research Areas for ABCE1 Recombinant Protein Antigen (NBP2-58061PEP)

Find related products by research area.

Blogs on ABCE1

There are no specific blogs for ABCE1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
IFN-gamma [Unconjugated]
285-IF-100
TRAIL/TNFSF10 [Unconjugated]
375-TL-010

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ABCE1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ABCE1