PLEKHM1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: PARIIHNWDLTKRPICRQALKFLTQIRAQPLINLQMVNASLYEHVERMHLIGR |
| Predicted Species |
Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PLEKHM1 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for PLEKHM1 Antibody - BSA Free
Background
PLEKHM1 - pleckstrin homology domain containing, family M (with RUN domain) member 1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Publications for PLEKHM1 Antibody (NBP2-38449) (0)
There are no publications for PLEKHM1 Antibody (NBP2-38449).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PLEKHM1 Antibody (NBP2-38449) (0)
There are no reviews for PLEKHM1 Antibody (NBP2-38449).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PLEKHM1 Antibody (NBP2-38449) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PLEKHM1 Products
Research Areas for PLEKHM1 Antibody (NBP2-38449)
Find related products by research area.
|
Blogs on PLEKHM1
![Immunocytochemistry/Immunofluorescence: PLEKHM1 Antibody [NBP2-38449] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PLEKHM1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38449-img0003.jpg "Immunocytochemistry/Immunofluorescence: PLEKHM1 Antibody [NBP2-38449] - Staining of human cell line U-2 OS shows localization to nucleoli & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human small intestine shows moderate cytoplasmic postivity in glandular cells.](http://images.novusbio.com/fullsize/PLEKHM1-Antibody-Immunohistochemistry-Paraffin-NBP2-38449-img0008.jpg "Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human small intestine shows moderate cytoplasmic postivity in glandular cells.")
![Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human cerebral cortex shows moderate postivity in neuropil.](http://images.novusbio.com/fullsize/PLEKHM1-Antibody-Immunohistochemistry-Paraffin-NBP2-38449-img0005.jpg "Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human cerebral cortex shows moderate postivity in neuropil.")
![Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human fallopian tube shows moderate cytoplasmic postivity in glandular cells.](http://images.novusbio.com/fullsize/PLEKHM1-Antibody-Immunohistochemistry-Paraffin-NBP2-38449-img0006.jpg "Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human fallopian tube shows moderate cytoplasmic postivity in glandular cells.")
![Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human placenta shows moderate granular cytoplasmic postivity in trophoblastic cells.](http://images.novusbio.com/fullsize/PLEKHM1-Antibody-Immunohistochemistry-Paraffin-NBP2-38449-img0007.jpg "Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human placenta shows moderate granular cytoplasmic postivity in trophoblastic cells.")
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")