Home » PPP4R4 » PPP4R4 Proteins » PPP4R4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PPP4R4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PPP4R4 Recombinant Protein Antigen (NBP2-48957PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PPP4R4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP4R4.

Source: E. coli

Amino Acid Sequence: SKAQLSQTVQSRLVSCKILGKLTNKFDAHTIKREILPLVKSLCQDVEYEVRSCMCRQLENIAQGIGTELTKSVVLPELIELSRDEGSSVRLAAFET

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP4R4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48957.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPP4R4 Recombinant Protein Antigen

  • KIAA1622PP4R4HEAT-like repeat-containing protein
  • protein phosphatase 4, regulatory subunit 4
  • serine/threonine-protein phosphatase 4 regulatory subunit 4

Background

The protein encoded by the PPP4R4 gene is a HEAT-like repeat-containing protein. The HEAT repeat is a tandemly repeated,37-47 amino acid long module occurring in a number of cytoplasmic proteins. Arrays of HEAT repeats form a rod-likehelical structure and appear to function as protein-protein interaction surfaces. The repeat-containing region of thisprotein has some similarity to the constant regulatory domain of the protein phosphatase 2A PR65/A subunit. Thefunction of this particular gene product has not been determined. Alternative splicing has been observed for this geneand two transcript variants encoding distinct isoforms have been identified. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPP4R1 Antibody
NBP1-87242
Immunocytochemistry/ Immunofluorescence PPP4R1 Antibody
Western Blot PPP4R1 Antibody
Western Blot PPP4R1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Annexin V
Apoptosis Kit [FITC]
NBP2-29373
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
Flow Cytometry Annexin V Apoptosis Kit [FITC]
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
PPP2R4 Antibody
(529245)
MAB5929
Western Blot PPP2R4 Antibody (529245)
Species: Hu, Mu, Rt
Applications: WB
PP4/PPP4C Antibody
(501517)
MAB5074
Western Blot PP4/PPP4C Antibody (501517)
(2 Publications)
Species: Hu
Applications: WB
PP2A alpha [p
Tyr307] Antibody [Unc ...
AF3989
Western Blot PP2A alpha [p Tyr307] Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB
PPP4R2 Antibody
NB100-2877
Immunoprecipitation PPP4R2 Antibody
Immunohistochemistry-Paraffin PPP4R2 Antibody
Western Blot PPP4R2 Antibody
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB

Publications for PPP4R4 Recombinant Protein Antigen (NBP2-48957PEP) (0)

There are no publications for PPP4R4 Recombinant Protein Antigen (NBP2-48957PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP4R4 Recombinant Protein Antigen (NBP2-48957PEP) (0)

There are no reviews for PPP4R4 Recombinant Protein Antigen (NBP2-48957PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPP4R4 Recombinant Protein Antigen (NBP2-48957PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPP4R4 Products

Research Areas for PPP4R4 Recombinant Protein Antigen (NBP2-48957PEP)

Find related products by research area.

Blogs on PPP4R4

There are no specific blogs for PPP4R4, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Flow Cytometry: Annexin V Apoptosis Kit [FITC] [NBP2-29373] - Adherent RAW cells treated with actinomycin-D, detached with a cell detachment solution and stained with the Annexin V Apoptosis Kit [FITC].
Annexin V Apoptosis Kit [FITC]
NBP2-29373-100Tests

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPP4R4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PPP4R4