![Western Blot: Pipecolic acid oxidase Antibody (3D1) [H00051268-M10] - Analysis of PIPOX expression in transfected 293T cell line by PIPOX monoclonal antibody (M10), clone 3D1. Lane 1: PIPOX transfected lysatE (44.1 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Pipecolic-acid-oxidase-Antibody-3D1-Western-Blot-H00051268-M10-img0003.jpg "Western Blot: Pipecolic acid oxidase Antibody (3D1) [H00051268-M10] - Analysis of PIPOX expression in transfected 293T cell line by PIPOX monoclonal antibody (M10), clone 3D1. Lane 1: PIPOX transfected lysatE (44.1 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IP |
| Clone | 3D1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | PIPOX (AAH27622.1, 292 a.a. ~ 384 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IGDVQILSSFVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHGFKLAPVVGKILYELSMKLTPSYDLAPFRISRFPG |
| Specificity | PIPOX - pipecolic acid oxidase (3D1) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PIPOX |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
| Publication using H00051268-M10 | Applications | Species |
|---|---|---|
| Khan AP, Rajendiran TM, Ateeq B et al. The role of sarcosine metabolism in prostate cancer progression. Neoplasia. 2013-05-01 [PMID: 23633921] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Pipecolic acid oxidase Antibody (H00051268-M10)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Pipecolic acid oxidase Antibody (3D1) [H00051268-M10] - Analysis of monoclonal antibody to PIPOX on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/Pipecolic-acid-oxidase-Antibody-3D1-Immunocytochemistry-Immunofluorescence-H00051268-M10-img0001.jpg "Immunocytochemistry/Immunofluorescence: Pipecolic acid oxidase Antibody (3D1) [H00051268-M10] - Analysis of monoclonal antibody to PIPOX on HeLa cell. Antibody concentration 10 ug/ml")
![Immunoprecipitation: Pipecolic acid oxidase Antibody (3D1) [H00051268-M10] - Analysis of PIPOX transfected lysate using anti-PIPOX monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PIPOX rabbit polyclonal antibody.](http://images.novusbio.com/fullsize/Pipecolic-acid-oxidase-Antibody-3D1-Immunoprecipitation-H00051268-M10-img0002.jpg "Immunoprecipitation: Pipecolic acid oxidase Antibody (3D1) [H00051268-M10] - Analysis of PIPOX transfected lysate using anti-PIPOX monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PIPOX rabbit polyclonal antibody.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
