![Western Blot: Methionine Sulfoxide Reductase B Antibody (8B2) [H00051734-M02] - Analysis of SEPX1 expression in transfected 293T cell line by SEPX1 monoclonal antibody (M02), clone 8B2.Lane 1: SEPX1 transfected lysate(12.713 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Methionine-Sulfoxide-Reductase-B-Antibody-8B2-Western-Blot-H00051734-M02-img0006.jpg "Western Blot: Methionine Sulfoxide Reductase B Antibody (8B2) [H00051734-M02] - Analysis of SEPX1 expression in transfected 293T cell line by SEPX1 monoclonal antibody (M02), clone 8B2.Lane 1: SEPX1 transfected lysate(12.713 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 8B2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | SEPX1 (NP_057416, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLN |
| Specificity | SEPX1 (8B2) |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MSRB1 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Methionine Sulfoxide Reductase B Antibody (H00051734-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Methionine Sulfoxide Reductase B Antibody (8B2) [H00051734-M02] - Analysis of monoclonal antibody to SEPX1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 1.5 ug/ml.](http://images.novusbio.com/fullsize/Methionine-Sulfoxide-Reductase-B-Antibody-8B2-Immunohistochemistry-Paraffin-H00051734-M02-img0004.jpg "Immunohistochemistry-Paraffin: Methionine Sulfoxide Reductase B Antibody (8B2) [H00051734-M02] - Analysis of monoclonal antibody to SEPX1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 1.5 ug/ml.")
![ELISA: Methionine Sulfoxide Reductase B Antibody (8B2) [H00051734-M02] - Detection limit for recombinant GST tagged SEPX1 is approximately 0.1ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Methionine-Sulfoxide-Reductase-B-Antibody-8B2-ELISA-H00051734-M02-img0007.jpg "ELISA: Methionine Sulfoxide Reductase B Antibody (8B2) [H00051734-M02] - Detection limit for recombinant GST tagged SEPX1 is approximately 0.1ng/ml as a capture antibody.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot Glutathione Peroxidase 4/GPX4 Antibody (565320) [Unconjugated]](https://images.novusbio.com/images2/Glutathione_Peroxidase_4_MAB5457_Western_Blot_6237.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")