Home » GRHL3 » GRHL3 Proteins » GRHL3 Recombinant Protein Antigen

GRHL3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GRHL3 Recombinant Protein Antigen (NBP2-57087PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GRHL3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GRHL3.

Source: E. coli

Amino Acid Sequence: VNGDDDSVAALSFLYDYYMGPKEKRILSSSTGGRNDQGKRYYHGMEYETDLTPLESPTHLMKFLTENVSGTPEYPDLLKKNNLMSL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GRHL3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57087.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GRHL3 Recombinant Protein Antigen

  • grainyhead-like 3 (Drosophila)
  • MGC46624
  • Sister of mammalian grainyhead
  • sister-of-mammalian grainyhead
  • SOMTranscription factor CP2-like 4grainyhead-like protein 3 homolog
  • TFCP2L4
  • transcription factor hSOM1

Background

The protein encoded by the GRHL3 gene is part of the grainyhead family of transcription factors and exists in 5 isoforms: isoform 1: 626 AA long, 70 kDA; isoform 2: 607 AA long, 68 kDA; isoform 3: 555 AA long, 62 kDA; isoform 4: 509 AA long; 57 kDA; isoform 5: 602 AA long, 67 kDA. The coded protein works as a transcription factor during development and initiates migration of endothelial cells. GRHL3 frequently interacts with genes GRHL1 and GRHL2. It has been associated with diseases spina bifida, tonsillitis, and prostatitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Somatostatin
Antibody (906552) [Un ...
MAB2358
Immunohistochemistry Somatostatin Antibody (906552) [Unconjugated]
Immunocytochemistry Somatostatin Antibody (906552) [Unconjugated]
Immunocytochemistry Somatostatin Antibody (906552) [Unconjugated]
(3 Publications)
Species: Hu, Mu
Applications: ICC, IHC
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry Neuropeptide Y Antibody
Immunocytochemistry/ Immunofluorescence Neuropeptide Y Antibody
(20 Publications)
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
VIP Antibody
(OTI1E8)
NBP2-46349
Immunohistochemistry VIP Antibody (OTI1E8)
Immunohistochemistry VIP Antibody (OTI1E8)
Immunohistochemistry VIP Antibody (OTI1E8)
Species: Hu
Applications: IHC, IHC-P, WB
Substance P
Antibody (266815)
MAB4375
Immunohistochemistry Substance P Antibody (266815)
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC
TFF2 Antibody
(366508) [Unconjugate
MAB4077
Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]
(2 Publications)
Species: Hu
Applications: IHC, WB
Procalcitonin
Antibody (44D9)
NB120-14817
Procalcitonin Antibody (44D9)
(1 Review)
(11 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Cholecystokinin
Antibody
NBP3-18225
Immunocytochemistry/ Immunofluorescence Cholecystokinin Antibody
Immunohistochemistry-Paraffin Cholecystokinin Antibody
Western Blot Cholecystokinin Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-P, WB
EN-RAGE/S100A12
Antibody [Unconjugate
AF1052
Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]
Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]
Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]
(3 Reviews)
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(232 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Neurotensin
Antibody
NBP2-33903
Immunohistochemistry-Paraffin Neurotensin Antibody
Immunohistochemistry-Paraffin Neurotensin Antibody
Immunohistochemistry-Paraffin Neurotensin Antibody
Species: Hu
Applications: IHC, IHC-P
Choline
Acetyltransferase/ChA
NBP1-30052
Immunohistochemistry-Paraffin Choline Acetyltransferase/ChAT Antibody
Immunocytochemistry/ Immunofluorescence Choline Acetyltransferase/ChAT Antibody
Immunocytochemistry/ Immunofluorescence Choline Acetyltransferase/ChAT Antibody
(24 Publications)
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
RIPK2 Antibody
(6F7)
H00008767-M02
ELISA RIPK2 Antibody (6F7)
Immunohistochemistry-Paraffin RIPK2 Antibody (6F7)
Western Blot RIPK2 Antibody (6F7)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
nNOS Antibody
NBP1-39681
Western Blot nNOS Antibody
Western Blot nNOS Antibody
Western Blot nNOS Antibody
(21 Publications)
Species: Bt, Ca, Eq, Hu, Pm, Mu, Pm, Rb, Rt
Applications: ICC, IHC, IHC-P, IP, WB
Galanin Antibody
(581403)
MAB5854
Intracellular Staining by Flow Cytometry Galanin Antibody (581403)
Immunohistochemistry Galanin Antibody (581403)
(1 Publication)
Species: Hu
Applications: CyTOF-reported, IHC, ICFlow
Galanin Antibody
(581403)
MAB5854
Intracellular Staining by Flow Cytometry Galanin Antibody (581403)
Immunohistochemistry Galanin Antibody (581403)
(1 Publication)
Species: Hu
Applications: CyTOF-reported, IHC, ICFlow
GCET2 Antibody
NBP1-82693
Western Blot GCET2 Antibody
Immunohistochemistry-Paraffin GCET2 Antibody
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB

Publications for GRHL3 Recombinant Protein Antigen (NBP2-57087PEP) (0)

There are no publications for GRHL3 Recombinant Protein Antigen (NBP2-57087PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRHL3 Recombinant Protein Antigen (NBP2-57087PEP) (0)

There are no reviews for GRHL3 Recombinant Protein Antigen (NBP2-57087PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GRHL3 Recombinant Protein Antigen (NBP2-57087PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRHL3 Products

Blogs on GRHL3

There are no specific blogs for GRHL3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

10x Magnification cryo-sections mouse: primary antibody: anti-rb TH: 1:500; o.n. secondary antibody: 1:500 dk-anti-rb DyLight488. IHC-Fr image submitted by a verified customer review.
Tyrosine Hydroxylase Antibody
NB300-109
Western Blot: iNOS Antibody [NB300-605] - Analysis of iNOS was performed by loading 20 ug of RAW264 whole cell lysate untreated (left lane) or stimulated with LPS at 1 ug/mL for 16 hours (right lane) and 10 uL of PageRuler Plus Prestained Protein Ladder onto a 4-20% Tris-Glycine polyacrylamide gel. Proteins were transferred to a nitrocellulose membrane and blocked with 5% Milk in TBST for at least 1 hour. The membrane was probed with an iNOS Rabbit polyclonal antibody at a dilution of 1:1000 overnight at 4C on a rocking platform, washed in TBST, and probed with a Goat anti-Rabbit IgG (H+L) Secondary Antibody, HRP conjugate at a dilution of 1:1000 for 1 hour. Chemiluminescent detection was performed using SuperSignal West Pico.
iNOS Antibody - BSA Free
NB300-605

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GRHL3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GRHL3