Recombinant Human CRLR GST (N-Term) Protein Summary
Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 23-132 of Human CALCRL Source: Wheat Germ (in vitro) Amino Acid Sequence: ELEESPEDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTH |
Preparation Method |
in vitro wheat germ expression system |
Details of Functionality |
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
Source |
Wheat germ |
Protein/Peptide Type |
Recombinant Protein |
Gene |
CALCRL |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
Theoretical MW |
37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -80C. Avoid freeze-thaw cycles. |
Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human CRLR GST (N-Term) Protein
Background
Calcitonin receptor-like receptor (CRLR) is an Adrenomedullin Receptor that requires two additional proteins to function: a chaperone protein RAMP (receptor activity modifying protein) and the component protein RCP. The function of CRLR depends on its interaction with RAMP. When coexpressed with RAMP1, CRLR acts as a receptor for calcitonin gene-related peptide (CGRP). In contrast, when CRLR is coexpressed with either RAMP2 or RAMP3, it acts as a receptor for adrenomedullin. Activation of the receptor leads to an increase in intracellular cyclic AMP. CRLR mediates the vasorelaxation of arteries, suggesting a potential role for the receptor in reaction to injury, particularly in the treatment of pulmonary hypertension. CRLR expression has been reported in brain, lung, blood vessel, liver, and intestinal tract. ESTs have been isolated from B-Cell/lung/testis, bone marrow, embryo, lung, and synovium libraries.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: IHC
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, KO
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, ICC
Species: Bt, Bv, Ca, Eq, Hu, Mu
Applications: IHC, IHC-P
Publications for CRLR Partial Recombinant Protein (H00010203-Q01) (0)
There are no publications for CRLR Partial Recombinant Protein (H00010203-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CRLR Partial Recombinant Protein (H00010203-Q01) (0)
There are no reviews for CRLR Partial Recombinant Protein (H00010203-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CRLR Partial Recombinant Protein (H00010203-Q01) (0)
Additional CRLR Products
Research Areas for CRLR Partial Recombinant Protein (H00010203-Q01)
Find related products by research area.
|
Blogs on CRLR