Novus Biologicals products are now on bio-techne.com

ADAMTS13 Recombinant Protein Antigen

Images

 
There are currently no images for ADAMTS13 Recombinant Protein Antigen (NBP3-21282PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

ADAMTS13 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAMTS13

Source: E.coli

Amino Acid Sequence: RYGSQLAPETFYRECDMQLFGPWGEIVSPSLSPATSNAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYILIRDTHSLRTTAFHGQQV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADAMTS13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21282. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ADAMTS13 Recombinant Protein Antigen

  • A disintegrin and metalloproteinase with thrombospondin motifs 13
  • a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 13
  • ADAM metallopeptidase with thrombospondin type 1 motif, 13
  • ADAMTS13
  • ADAM-TS13
  • ADAMTS-13
  • DKFZp434C2322
  • EC 3.4.24.14
  • EC 3.4.24.82
  • EC 3.4.24.87
  • FLJ42993
  • MGC118899
  • MGC118900
  • TTP
  • TTPADAM-TS 13
  • vWF-cleaving protease
  • vWF-CP
  • vWF-CPC9orf8
  • VWFCPvon Willebrand factor-cleaving protease

Background

ADAMTS13 was first identified by its ability to cleave the ultra large aggregates of vWF into smaller forms in the serum. A thrombocytopenic disorder called thrombic thrombocytopenic purpura (TTR) was shown to be due to a deficiency in the cleavage of von Willebrands factor, and ADAMTS13 was identified as the enzyme responsible. ADAMTS13 cleaves the Tyr1605 to Met1606 bond in the A2 domain of vWF, a process stimulated by shear stress in the circulation and by binding to either platelet glycoprotein IBa or to heparin. The cleaved vWF leads to decreased platelet adhesion. An idiopathic form of TTR is found in patients with auto antibodies to ADAMTS13. The full length ADAMTS-1 sequence codes for a 1,427 amino acid protein, with a predicted mass of 153.6 kDa, but glycosylation and the abundance of cysteine residues gives ADAMTS-13 an apparent molecular weight of about 190 kDa on reduced SDS PAGE gels. The variants reported include 1,371, 1,340 and 344 amino acids, with predicted mass of 130.3, 144.5 and 36.7 kDa respectively. Many bands of varying sizes can be seen on Western blots, between 110-190 kDa, perhaps indicating differentially processed ADAMTS-13.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-02105
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
1129-ER
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
DTSP10
Species: Hu
Applications: ELISA
NBP1-31851
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-89228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-33950
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ADAMTS13 Recombinant Protein Antigen (NBP3-21282PEP) (0)

There are no publications for ADAMTS13 Recombinant Protein Antigen (NBP3-21282PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAMTS13 Recombinant Protein Antigen (NBP3-21282PEP) (0)

There are no reviews for ADAMTS13 Recombinant Protein Antigen (NBP3-21282PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ADAMTS13 Recombinant Protein Antigen (NBP3-21282PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAMTS13 Products

Research Areas for ADAMTS13 Recombinant Protein Antigen (NBP3-21282PEP)

Find related products by research area.

Blogs on ADAMTS13

There are no specific blogs for ADAMTS13, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ADAMTS13 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAMTS13