![Western Blot: ZRSR2 Antibody [H00008233-B01P] - Analysis of U2AF1L2 expression in human placenta.](http://images.novusbio.com/fullsize/ZRSR2-Antibody-Western-Blot-H00008233-B01P-img0008.jpg "Western Blot: ZRSR2 Antibody [H00008233-B01P] - Analysis of U2AF1L2 expression in human placenta.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | U2AF1L2 (NP_005080, 1 a.a. - 482 a.a.) full-length human protein. MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEEEKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFYEDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNSRSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPKSK |
| Specificity | U2(RNU2) small nuclear RNA auxiliary factor 1-like 2 |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | ZRSR2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against transfected lysate and tissue lysate for WB. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Immunogen affinity purified |
![Bioactivity C1QL1 [Unconjugated]](https://images.novusbio.com/images2/C1qL1_9134TN_1238.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: ZRSR2 Antibody [H00008233-B01P] - Analysis of ZRSR2 expression in transfected 293T cell line by ZRSR2 polyclonal antibody. Lane 1: U2AF1L2 transfected lysate(53.02 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ZRSR2-Antibody-Western-Blot-H00008233-B01P-img0009.jpg "Western Blot: ZRSR2 Antibody [H00008233-B01P] - Analysis of ZRSR2 expression in transfected 293T cell line by ZRSR2 polyclonal antibody. Lane 1: U2AF1L2 transfected lysate(53.02 KDa). Lane 2: Non-transfected lysate.")
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/Endothelin-1_QET00_ELISA_432.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/DATA_Endothelin1_QET00_ELISA_1074.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")