![Sandwich ELISA: ZRSR2 Antibody (2H5) [H00008233-M03] - Detection limit for recombinant GST tagged ZRSR2 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ZRSR2-Antibody-2H5-Sandwich-ELISA-H00008233-M03-img0001.jpg "Sandwich ELISA: ZRSR2 Antibody (2H5) [H00008233-M03] - Detection limit for recombinant GST tagged ZRSR2 is 0.1 ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | ELISA |
| Clone | 2H5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | U2AF1L2 (NP_005080.1, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRQLQCEFCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKNSERRERMGHHDDYYSRLRGRRNPSPDHSYKRNG |
| Specificity | U2AF1L2 - U2(RNU2) small nuclear RNA auxiliary factor 1-like 2 (2H5) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ZRSR2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Bioactivity C1QL1 [Unconjugated]](https://images.novusbio.com/images2/C1qL1_9134TN_1238.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/Endothelin-1_QET00_ELISA_432.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/DATA_Endothelin1_QET00_ELISA_1074.jpg)
