Home » Vitronectin » Vitronectin Proteins » Vitronectin Recombinant Protein Antigen

Vitronectin Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

Vitronectin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Vitronectin.

Source: E. coli

Amino Acid Sequence: KCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
VTN
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38901.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Vitronectin Recombinant Protein Antigen

  • Complement S-protein
  • epibolin
  • Serum Spreading Factor
  • Serum-spreading factor
  • Somatomedin B
  • S-protein
  • V75
  • vitronectin (serum spreading factor, somatomedin B, complement S-protein)
  • Vitronectin
  • VN
  • VNT
  • VTN

Background

Vitronectin also called serum spreading factor or complement S-protein, is a member of the pexin family (1). Found in serum and in tissues, Vitronectin exist in two forms; as a single chain (75kDa) and as a clipped form composed of two chains (65kDa and 10kDa). Vitronectin promotes cell adhesion, spreading and migration through specific interactions with cellular integrins, and inhibits cytolysis by the complement C5b-9 complex (2-4). Vitronectin also interacts with several critical proteins that regulate thrombosis and fibrinolysis. Vitronectin is phosphorylated by PKA and CKII (5).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Serpin E1/PAI-1
[HRP]
DSE100
N/A Serpin E1/PAI-1 [HRP]
N/A Serpin E1/PAI-1 [HRP]
(46 Publications)
Species: Hu
Applications: ELISA
u-Plasminogen
Activator/Urokinase [ ...
1310-SE
Enzyme Activity u-Plasminogen Activator/Urokinase [Unconjugated]
(14 Publications)
Species: Hu
Applications: EnzAct
uPAR [HRP]
DUP00
N/A uPAR [HRP]
N/A uPAR [HRP]
(44 Publications)
Species: Hu
Applications: ELISA
Angiostatin
Antibody [Unconjugate ...
AF226
Angiostatin Antibody [Unconjugated] - Kringle 1-3
(8 Publications)
Species: Hu
Applications: WB
Integrin alpha V
beta 3 [Unconjugated]
3050-AV
Integrin alpha V beta 3 [Unconjugated]
(25 Publications)
Species: Hu
Applications: Bind
FAK Antibody
(495919) [Unconjugate
MAB4467
Immunohistochemistry FAK Antibody (495919) [Unconjugated]
Western Blot FAK Antibody (495919) [Unconjugated]
Knockout Validated FAK Antibody (495919) [Unconjugated]
(2 Publications)
Species: Hu
Applications: IHC, KO, Simple Western, WB
Osteopontin/OPN
Antibody [Unconjugate
AF808
Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]
Neutralization Osteopontin/OPN Antibody [Unconjugated]
Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]
(2 Reviews)
(209 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
PRAP1 Antibody -
BSA Free
NBP1-80633
Immunohistochemistry-Paraffin PRAP1 Antibody - BSA Free
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(56 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Von Willebrand
Factor Antibody - BSA ...
NB600-586
Dual RNAscope ISH-IHC Von Willebrand Factor Antibody - BSA Free
Immunohistochemistry-Frozen Von Willebrand Factor Antibody - BSA Free
Immunohistochemistry Von Willebrand Factor Antibody - BSA Free
(3 Reviews)
(14 Publications)
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(822 Publications)
Species: Hu
Applications: BA
Tenascin C
Antibody (4C8MS) - BS
NB110-68136
Flow Cytometry Tenascin C Antibody (4C8MS) - BSA Free
Immunocytochemistry/ Immunofluorescence Tenascin C Antibody (4C8MS) - BSA Free
Flow Cytometry Tenascin C Antibody (4C8MS) - BSA Free
(2 Reviews)
(26 Publications)
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
t-Plasminogen
Activator/tPA [HRP]
DTPA00
N/A t-Plasminogen Activator/tPA [HRP]
N/A t-Plasminogen Activator/tPA [HRP]
(7 Publications)
Species: Hu
Applications: ELISA
Clusterin/APOJ
Antibody [Unconjugate
AF2747
Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]
Immunohistochemistry Clusterin/APOJ Antibody [Unconjugated]
Western Blot Clusterin/APOJ Antibody [Unconjugated]
(13 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Integrin beta
1/CD29 Antibody (P5D2 ...
MAB17781
Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
Immunocytochemistry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]
(36 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Publications for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP) (0)

There are no publications for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP) (0)

There are no reviews for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Vitronectin Products

Research Areas for Vitronectin Recombinant Protein Antigen (NBP2-38901PEP)

Find related products by research area.

Blogs on Vitronectin

There are no specific blogs for Vitronectin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Osteopontin/OPN was detected in immersion fixed C2C12 mouse myoblast cell line (left panel, positive stain) and mouse splenocytes (right panel, negative stain) using Goat Anti-Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and secreted molecule. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Osteopontin/OPN Antibody [Unconjugated]
AF808

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Vitronectin Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol VTN